ORFeome > MGC79565 – XORFeome 2.0

MGC79565 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC79565 protein, mRNA (cDNA clone MGC:79565 IMAGE:6978626), complete cds
Gene Symbol: MGC79565
Gene ID: 493283
ORF gb_acc: MG133616
ORF ID: 11156

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080336

Library Location

Plate ID: GDExt11011
Well Location: A11

EST Sequences

Clone: MGC:79565 IMAGE:6978626
Trimmed Sequence: ATGGCGGGGAAGAGCGGGGAGGAGAAGATGAAGGCGATGGAGGCGGAGATGGCGCTGTTTGAGCAGGAAGTACTGGGAGCTCCCGTGGCGCTGCCTCCAGTGGATCCCGTGCCCTTGCCCATCCCAGCTGTGCCTGTTATACGGGCGATTATTGCCACTAACACCTATAGCCAGGTGCAGCAGAGTCTAGAGGCGAGGGCAGCCGCTGCGGCCAGTGTCGTGGGGCCCATGATTGTTCCACCGGTGCCATTTGTTGGCCCAGCCATCCCACCACCTAGACCACCAGTTATGAGGCCCAGTTTCATCCCCCATGCTCTGCAGCGACCAGCCGAGCCTCACGGAGCAATGCCCCGCCCTTCCTTCATTCCTCATGTCTTGCAGCAAAGAGCTGTTGGCCCCCGACACCCAGGGATGCCTCCCCCACAGCCTTTAATGGCCCATCACATGCATGGCCCGCCTCCACCACTGATGAGACACATCCCGCCTCCTCCGCTTGGCATGCGTGCTGGCCCCCCGCCTGCACCTGTGGGACCTCTGCCTCCCCCGCCCCGCCCTGTGGTACCGTCTGCTCCAAAGATGAACCCTACCGTTATCCAAGCTGCCCCCACTGTCTATACTGCACCCCCAGTAAGGAAGCCAGAGGAGGAAATTGTGGAGCCGCCAATATTACCGGATGAGAAGGAAACTCTCAGCTTTGAAGAAGCCGTTATTGGCCCCAGTATGCCGGAAATGGAACCGGTGCAGCCCGAGGTGGTACTGGAACCGGTACAGGAGGATAAAAAGAAAACAAAGCCGGAGAAATTAAAACGGTGCATTCGCACTGCGGCCGGAACATCCTGGGAAGATCAGAGCTTATTGGAATGGGAGTCAGATGACTTCCGGATATTCTGCGGGGATCTGGGAAACGAGGTGAACGACGACATCCTGGCTCGCGCTTTCAGCCGTTACCCCTCCTTCCTGAGGGCCAAAGTCATCCGGGATAAACGCACGGGGAAGACTAAAGGCTACGGGTTCGTGAGCTTCAAGGATCCCAACGACTACGTGAGGGCCATGCGCGAAATGAACGGCAAATACGTGGGCTCTCGGCCCATAAAGCTGCGCAAGAGCCAATGGAAAGATCGCAATATGGACGTGGTGCGCAAGAAGCAGAGGGAGAAGAAGAAGCTCGGCCTGAGATAG
Full Trace Sequence: gcggatagttagaacctttgcggctaacgggttgcgttctgtgaagcgtcaggatggcggggaagagcggggaggagaagatgaaggcgatggaggcggagatggcgctgtttgagcaggaagtactgggagctcccgtggcgctgcctccagtggatcccgtgcccttgcccatcccagctgtgcctgttatacgggcgattattgccactaacacctatagccaggtgcagcagagtctagaggcgagggcagccgctgcggccagtgtcgtggggcccatgattgttccaccggtgccatttgttggcccagccatcccaccacctagaccaccagttatgaggcccagtttcatcccccatgctctgcagcgaccagccgagcctcacggagcaatgccccgcccttccttcattcctcatgtcttgcagcaaagagctgttggcccccgacacccagggatgcctcccccacagcctttaatggcccatcacatgcatggcccgcctccaccactgatgagacacatcccgcctcctccgcttggcatgcgtgctggccccccgcctgcacctgtgggacctctgcctcccccgccccgccctgtggtaccgtctgctccaaagatgaaccctaccgttatccaagctgcccccactgtctatactgcacccccagtaaggaagccagaggaggaaattgtggagccgccaatattaccggatgagaaggaaactctcagctttgaagaagccgttattggccccagtatgccggaaatggaaccggtgcagcccgaggtggtactggaaccggtacaggaggataaaaagaaaacaaagccggagaaattaaaacggtgcattcgcactgcggccggaacatcctgggaagatcagagcttattggaatgggagtcagatgacttccggatattctgcggggatctgggaaacgaggtgaacgacgacatcctggctcgcgctttcagccgttacccctccttcctgagggccaaagtcatccgggataaacgcacggggaagactaaaggctacgggttcgtgagcttcaaggatcccaacgactacgtgagggccatgcgcgaaatgaacggcaaatacgtgggctctcggcccataaagctgcgcaagagccaatggaaagatcgcaatatggacgtggtgcgcaagaagcagagggagaagaagaagctcggcctgagatagagacagaaccacaggcatggactccatattgtcccccgtttctgtgtgagtgggggtgctccgtccctccagctgttacacacaagcaagcaccccatgtaacggctggagggccacagacatttacacctatccaggttgctgggccctgagtggccaataaagggtctccactccggggagtgtttggtttgtattctatgcgcttacccaggacaaacagttacgttgtattttatatttcctcctcgttacttttaatttaatgacaaaccgacgctggctccgcctgcactggatctgctaattaaaccttaaagggccggcgtctgctgttgttgttaaattctctgcccaagttgatgacaattcactttattcgattaagaaaataaagttttattgtttttaaaactaaaaaaaaaaaaaaaa
Translation: MAGKSGEEKMKAMEAEMALFEQEVLGAPVALPPVDPVPLPIPAVPVIRAIIATNTYSQVQQSLEARAAAAASVVGPMIVPPVPFVGPAIPPPRPPVMRPSFIPHALQRPAEPHGAMPRPSFIPHVLQQRAVGPRHPGMPPPQPLMAHHMHGPPPPLMRHIPPPPLGMRAGPPPAPVGPLPPPPRPVVPSAPKMNPTVIQAAPTVYTAPPVRKPEEEIVEPPILPDEKETLSFEEAVIGPSMPEMEPVQPEVVLEPVQEDKKKTKPEKLKRCIRTAAGTSWEDQSLLEWESDDFRIFCGDLGNEVNDDILARAFSRYPSFLRAKVIRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGKYVGSRPIKLRKSQWKDRNMDVVRKKQREKKKLGLR
Donor tissue: tailbud