ORFeome > MGC79585 – XORFeome 2.0

MGC79585 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC79585 protein, mRNA (cDNA clone MGC:79585 IMAGE:6979019), complete cds
Gene Symbol: MGC79585
Gene ID: 493406
ORF gb_acc: MG133654
ORF ID: 11204

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080929

Library Location

Plate ID: GDExt11011
Well Location: D11

EST Sequences

Clone: MGC:79585 IMAGE:6979019
Trimmed Sequence: ATGCCACCCAAAAAGGCAGACGATGGACCAAAACAGCACCCTATCATTGGAAGGTTTGGGACCTCTTTGAAGATTGGAATTGTTGGACTGCCAAATATAGGGAAATCGACTTTCTTTAATGTGTTGACAAAGAGCCAGGCAGCAGCAGAAAACTTTCCATTCTGTACCATTAATCCAAACGAGAGCAGAGTACCTGTTCCAGATGAGAGATTTGAATTCCTGTGTCAGTACCACAAACCCGCAAGCAAAGTTCCAGCCTTTCTGAATGTGGTGGATATAGCAGGCCTCGTGAAAGGAGCAAGTACAGGACAAGGCTTAGGCAATGCATTCTTGTCAAACATTAGCGCGTGTGATGGAATTTTTCACCTGATGCGTGCTTTTGATGATGATGATATCATCCACGTTGAAGGAAGCGTCAACCCTGTACGTGACATTGAGATCATACACGAAGAACTGCGGCTGAAGGATGAAGAAATGATCATTGCTGCTCTTGATAAGCTTGAGAAAGTGGCAGTAAGAGGCGGTGACAAAAAGTTAAAACCAGAATATGACATAATGTGCAAAGTCAAAAACTGGATAATAGATGAAAAGAATCATGTGCGCTTTTACCATGACTGGAACGACAAGGAGATTGACGTATTAAATAAATACTTATTCCTGACATCCAAGCCGATGATCTATTTAGTTAATCTATCAGAAAAAGATTACATCCGCAAGAAAAACAAATGGTTGATAAAAATTAAGGAGTGGGTGGACAAGTATGACCCATGTGCCTTGGTCATTCCTTTTAGTGGGGTCTTGGAGCTCAACCTGCAAGACATGAGTGATGAGGAAAAGCACAAGTATCTGCAAGAGAAAGTGACACAAAGTGTCTTATCCAAGATTGTTAAAACCGGATATGCGGCACTCCAACTCGAATACTTCTTCACAGCCGGCCCCGATGAAGTACGTGCCTGGACCATCAAGAAAGGGACGAAGGCTCCTCAGGCTGCAGGCAAGATCCACACAGATTTTGAGAAGGGTTTCATTATGGCGGAAGTAATGAAATTTGATGATTTTAAAGAAGAAGGCTCAGAGTCATCTGTCAAGGCTGCAGGAAAATACCGACAACAAGGCAGGAATTACACAGTAGAAGACGGAGACATTATCTTCTTTAAGTTTAATACACCTCAGCAATCCAAAAAGAAATAA
Full Trace Sequence: gatcctgaggccccacgcctgcagtccgggaagccttcctactccgtctggagggacacgtgttgagcaactaggatgccacccaaaaaggcagacgatggaccaaaacagcaccctatcattggaaggtttgggacctctttgaagattggaattgttggactgccaaatatagggaaatcgactttctttaatgtgttgacaaagagccaggcagcagcagaaaactttccattctgtaccattaatccaaacgagagcagagtacctgttccagatgagagatttgaattcctgtgtcagtaccacaaacccgcaagcaaagttccagcctttctgaatgtggtggatatagcaggcctcgtgaaaggagcaagtacaggacaaggcttaggcaatgcattcttgtcaaacattagcgcgtgtgatggaatttttcacctgatgcgtgcttttgatgatgatgatatcatccacgttgaaggaagcgtcaaccctgtacgtgacattgagatcatacacgaagaactgcggctgaaggatgaagaaatgatcattgctgctcttgataagcttgagaaagtggcagtaagaggcggtgacaaaaagttaaaaccagaatatgacataatgtgcaaagtcaaaaactggataatagatgaaaagaatcatgtgcgcttttaccatgactggaacgacaaggagattgacgtattaaataaatacttattcctgacatccaagccgatgatctatttagttaatctatcagaaaaagattacatccgcaagaaaaacaaatggttgataaaaattaaggagtgggtggacaagtatgacccatgtgccttggtcattccttttagtggggtcttggagctcaacctgcaagacatgagtgatgaggaaaagcacaagtatctgcaagagaaagtgacacaaagtgtcttatccaagattgttaaaaccggatatgcggcactccaactcgaatacttcttcacagccggccccgatgaagtacgtgcctggaccatcaagaaagggacgaaggctcctcaggctgcaggcaagatccacacagattttgagaagggtttcattatggcggaagtaatgaaatttgatgattttaaagaagaaggctcagagtcatctgtcaaggctgcaggaaaataccgacaacaaggcaggaattacacagtagaagacggagacattatcttctttaagtttaatacacctcagcaatccaaaaagaaataatttttaattttgaagcagaagtgggagataaaaaaaaaaactctacttcattggtaaaatttacattttgttttttattttaatttagacagaatgcaaaaaataacaagacagtgaaatcccccccctcccccccaaggaaaaccaaatgtttatattccaactggaatatgtcacctcctgcaaagcaatagcagcccagtcaatgtgcttttcagatgattaagacccttctgcaaagcacagaagcctctctgcaaccacccaagtctcatgatagttcattaatctccatcatgtatgccaaggctgacacatctgacagaaaggacaatgtgcggcgctccgttcggaatctacagataatgcatgttttacagtactccagatgtcgacactcaataaaacatttgacaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPPKKADDGPKQHPIIGRFGTSLKIGIVGLPNIGKSTFFNVLTKSQAAAENFPFCTINPNESRVPVPDERFEFLCQYHKPASKVPAFLNVVDIAGLVKGASTGQGLGNAFLSNISACDGIFHLMRAFDDDDIIHVEGSVNPVRDIEIIHEELRLKDEEMIIAALDKLEKVAVRGGDKKLKPEYDIMCKVKNWIIDEKNHVRFYHDWNDKEIDVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPCALVIPFSGVLELNLQDMSDEEKHKYLQEKVTQSVLSKIVKTGYAALQLEYFFTAGPDEVRAWTIKKGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKEEGSESSVKAAGKYRQQGRNYTVEDGDIIFFKFNTPQQSKKK
Donor tissue: tailbud