ORFeome > MGC79637 – XORFeome 2.0

MGC79637 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC79637 protein, mRNA (cDNA clone MGC:79637 IMAGE:6980045), complete cds
Gene Symbol: MGC79637
Gene ID: 493421
ORF gb_acc: MG133599
ORF ID: 11136

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080945

Library Location

Plate ID: GDExt11012
Well Location: F02

EST Sequences

Clone: MGC:79637 IMAGE:6980045
Trimmed Sequence: ATGGTTGGCAGACTGAACCTGCAGGATGTCCCTGATCTGCTGGACATGAAGAAGAAAGGTGAAAGGGTGTTGGACAGCCCGGATTCTGGGCTCCCCCCCAGCCCCTGCCCTAGTAACTGGCACCTGTCTGCTGGCACAGCTGAGAAATCCCCCGAGCAAGACATCTCTGGGCAAAATGCCCCAGCAAATTTGGCCCTCTCATTAAGCTTATCAAGCAGCTTTACGCCAAGACTGTGCCCTTTATCGTTTGGAGAGGGTGTGGAGTTTGATCCGTTGCCACCAAAGGAGATAAGGTACACCTCATCAGTTAAATATGATTCTGAGAAGCATTTTATTGACAACATCTACATGCCAATGGGATTAGGCCTCTCCTCCTGCAGCCAATCTGTGATCTGTGTACCCAACTGTACATGGCGCAATTACAGAGCAGAAGTTCATTTAGAACCCAAGAACAAACCTCAGAGATTCAAGAGCACCACCATTGTTTATCCCAAGCACACAAAGGTTATTTATACCACTACCCTGGATTACAACTGCAAGAAGTGCATGAGGCGCTTTCTATCCAGCGTAGAGCTGGAATCTGCCGAACACCTGGGCACCGAGTGCTTCGGAGATGATTATTAG
Full Trace Sequence: ctggggctgacagcaatgcaactgtgagctcttctctcattaacgggacagcctattttgccctaacggagcggtgccaattgcactcacattgcaagtggcacaagagagagagaggagccctattgagtggccggtagcgatggttggcagactgaacctgcaggatgtccctgatctgctggacatgaagaagaaaggtgaaagggtgttggacagcccggattctgggctcccccccagcccctgccctagtaactggcacctgtctgctggcacagctgagaaatcccccgagcaagacatctctgggcaaaatgccccagcaaatttggccctctcattaagcttatcaagcagctttacgccaagactgtgccctttatcgtttggagagggtgtggagtttgatccgttgccaccaaaggagataaggtacacctcatcagttaaatatgattctgagaagcattttattgacaacatctacatgccaatgggattaggcctctcctcctgcagccaatctgtgatctgtgtacccaactgtacatggcgcaattacagagcagaagttcatttagaacccaagaacaaacctcagagattcaagagcaccaccattgtttatcccaagcacacaaaggttatttataccactaccctggattacaactgcaagaagtgcatgaggcgctttctatccagcgtagagctggaatctgccgaacacctgggcaccgagtgcttcggagatgattattagatctattttctccttactgtcaaagtttaagaacctaatcattttggtattactgtgacactttgatcacaataattacagccaagcatattacataaagacagctttgaagtatttgacactgaaaatggaccgtcttccagaacccagactcagtgtgagatttgataggtctgtggtaatgagatttactgtaggcaaacggtttccctctgtgaattggtgggaactggcactcactgcaaatccatccctgtgtgagccctgaaatcatctgcttttgacatttacatacttatgaaaggttttctcatgactgtgaaagttatcatttagaagctggtctttctccaaaaaaaaaataaaaagaagaaagaactattctgcctctatttacacaagaagagaatattatgtcatgtgcctccaatatcatatatctgaacaatgactaaaagtcatgggctcaaatatatatttgtcctacggagctgaaagtcaaacgaaagataaaacagacaaaataccaaatcatcggtgccttatatttaatcgcaaactaaacatggatatatttggtgaaatgaatttaaggatatgagtaaatagttgtatatttttcaactttgctttcaaataaacccctttgctgtatggccagtgaggttactaattctaatgctgaactggaattgtcacttcctcacagggagaaaagcctgaaatatgacaaattaatctcatcctctcactgcaaagggttaaggtgccttgtctttatttctgaccctcaaactgtgtttttttccctaaactgttttgtacagaaaataaagcacctaaggaaatgaattcatctcaatattggtgccacaaatgtatagcccataacctacaaatactgcctggtgtttctaatagaaacgcacatcattataccaaagatacaaacatgagatacagtaaatattaaaataattatataatataataatatactgtatatagcatacatctgtcaagccgttttattttatttgccagtgccatacaaatgttagaagctctgtagctataagacactgtactgtactgaatattttgtttggaagtgttacatgcagtcctgcaatctgtgaatactttttttgtatattgctgacaaatatcaggcatctggcggagtacaccttcattaaatatgatgaccttggaatgtatctcaaaatcaataaaattaaacagtataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVGRLNLQDVPDLLDMKKKGERVLDSPDSGLPPSPCPSNWHLSAGTAEKSPEQDISGQNAPANLALSLSLSSSFTPRLCPLSFGEGVEFDPLPPKEIRYTSSVKYDSEKHFIDNIYMPMGLGLSSCSQSVICVPNCTWRNYRAEVHLEPKNKPQRFKSTTIVYPKHTKVIYTTTLDYNCKKCMRRFLSSVELESAEHLGTECFGDDY
Donor tissue: tailbud