ORFeome > MGC79690 – XORFeome 2.0

MGC79690 – XORFeome 2.0

General Information

Species: Xenopus tropicalis RAB5A, member RAS oncogene family, mRNA (cDNA clone MGC:79690 IMAGE:6980837), complete cds
Gene Symbol: MGC79690
Gene ID: 493430
ORF gb_acc: MG133736
ORF ID: 11304

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080959

Library Location

Plate ID: GDExt11013
Well Location: A03

EST Sequences

Clone: MGC:79690 IMAGE:6980837
Trimmed Sequence: ATGGCAAACCGAGGCGGAGCTACCAGACCGAATGGACCGAATGCAGGAAATAAAATCTGTCAGTTTAAACTTGTCCTTTTAGGAGAATCCGCAGTTGGAAAGTCTAGTCTAGTGCTTCGCTTCGTAAAGGGACAGTTTCACGAATTCCAAGAGAGCACAATTGGAGCTGCTTTCCTTACCCAAACAGTCTGTCTCGATGATACAACTGTAAAATTTGAAATTTGGGATACAGCTGGTCAAGAGAGGTATCACAGCTTGGCCCCAATGTACTACAGGGGAGCCCAAGCTGCAATAGTTGTATATGACATTACAAATGAGGAATCATTTGCTAGAGCAAAGAACTGGGTAAAAGAGCTTCAGAGACAGGCAAGCCCCAATATTGTGATAGCTTTATCTGGTAACAAAGCTGATCTGGCCTCAAAGAGAGCTGTGGATTTTCAAGAAGCTCAAGCTTACGCAGATGACAACAGCTTATTGTTCATGGAGACTTCTGCTAAGACATCAGTGAATGTGAATGAGATATTCATGGCTATAGCTAAAAAGCTTCCCAAGACGGAACCACAGGCTGGAGGAAGCAACACCATCAGAGGAAGAGGAGTAGACCTTACTGAAACAGCACAACCTACCAAAAGTCAATGCTGTAGTAACTAA
Full Trace Sequence: caagaagctggacgttaacggcgttgcgggacgtttaagcagcgatccgggagcccgggctgtgtgaggaaatcggctctgtcccgcgaagagcgggcctgtttggcgattgccagaaggataagtgagcatccaacccaccctttgcttattgggctgcagccgactttgtaatcatcagacgttttgcctacaatcaaacatggcaaaccgaggcggagctaccagaccgaatggaccgaatgcaggaaataaaatctgtcagtttaaacttgtccttttaggagaatccgcagttggaaagtctagtctagtgcttcgcttcgtaaagggacagtttcacgaattccaagagagcacaattggagctgctttccttacccaaacagtctgtctcgatgatacaactgtaaaatttgaaatttgggatacagctggtcaagagaggtatcacagcttggccccaatgtactacaggggagcccaagctgcaatagttgtatatgacattacaaatgaggaatcatttgctagagcaaagaactgggtaaaagagcttcagagacaggcaagccccaatattgtgatagctttatctggtaacaaagctgatctggcctcaaagagagctgtggattttcaagaagctcaagcttacgcagatgacaacagcttattgttcatggagacttctgctaagacatcagtgaatgtgaatgagatattcatggctatagctaaaaagcttcccaagacggaaccacaggctggaggaagcaacaccatcagaggaagaggagtagaccttactgaaacagcacaacctaccaaaagtcaatgctgtagtaactaactaaaggcttcttgttctttaaactgtatggatattatcttgcttcctaattgttaataacaatttagtgtttaatcctgtcttggccttggtgccagccctttcagagcaatgcattgcaagcccccatggcagtgagtatgttaaactaggccctgtgaaaactaataaagggagacttgccgtgtggtctcatacataatacagagttattttactgctaattctgattttttctttttaacatgcatgcattatgttctacaagctgttctcagtgtgggagaataggccggtgtattatacagagctttatcagatgcaggaccttggagagaacaatactggtctctgcaatgcattgcaaacttctgggtgcaaagtagaaatggttatattattacggtgacaattagcccaaagtggaacttttaaaacttttgtttttctaaaaaagaaaaagaaaaaaaaagatttttttaagctaatacaagcagggtataaaaatctattctcatctctctttacagtgtttgctcaaaatcaccttctccaaaatccagctctacattccgcttattaatttatagcttgttagccactaattcctccgctttcttcagatgagaccgataaacagaatattgtttgattacgccaataacccacaaatgtttaggggatgagcttagtttttatttcatagacaagtaccgagaatcgtgtttaacactgatcaattctattcaaggtgattagcgtgcaaagccatttttattatcctttccagcgccatcttcacagaacaccgaactttttcttttttttcttcattttttatttttatatccagttttacccaatacaaaacaaaaactgcaatgttctaataatgatgtatactcaatttagctatcttaaaattggatggtaaaattgtaatgtaaatagggtactaaccatagtctacatttatgtttaatatgttctgttacttgtaagatttggttaaattgtacagttaactaaaatgataaaaataaaaagctaatggtttttcctctaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MANRGGATRPNGPNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLASKRAVDFQEAQAYADDNSLLFMETSAKTSVNVNEIFMAIAKKLPKTEPQAGGSNTIRGRGVDLTETAQPTKSQCCSN
Donor tissue: tailbud