ORFeome > MGC79749 – XORFeome 2.0

MGC79749 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC79749 protein, mRNA (cDNA clone MGC:79749 IMAGE:6983689), complete cds
Gene Symbol: MGC79749
Gene ID: 493526
ORF gb_acc: MG133669
ORF ID: 11223

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082346

Library Location

Plate ID: GDExt11012
Well Location: D05

EST Sequences

Clone: MGC:79749 IMAGE:6983689
Trimmed Sequence: ATGGGGAACACCAAGAGTGGGGCTCTTTCAAAAGAGGTCCTAGAAGATCTTAAAGCAAACACAAGGTACTCAGATGATGAACTCTGCAAGTGGTATGAGAGTTTCAGCAAGCAGAGCCCCAATGGCAAAATCACTCGCACAGAGTTTGAGAAGATCTACGCCAATTTCTTTCCCAATTCTGATCCCAAGAGCTACGCCAGGCACGTGTTCCGCAGCTTCGACACCAATGAAGATGGTACCTTGGACTTCCGGGAGTACATCATTGCCCTGCATCTCACTTCTTCTGGGAAAACCAGCCTCAAGCTAGAGTGGGCATTTTCCCTGTTTGATGTAGACAAGAATGGGGAAATCAGCAAGGTCGAAGTGCTTGAAATTATTACAGCAATTTTCAAGATGATCCCACCAGAAGAGCAGAAGAACCTGGCAGATGATGAAAATACCCCACAAAAAAGAGCAGACAAGCTATGGGCCTACTTCAAAAAGAGTGATGATGCGAAAATCGCCGAGGGAGAATTCATTCAGGGCATTATGATGAACGACGAGATCATGAGACTTATTCAGTACGACCCAAGAAAAAAATAA
Full Trace Sequence: ctcgaagggcattgtgtctggtgagaagctaggagacccagattctgctgctgacgctttagagcagcagggtgacaatggggaacaccaagagtggggctctttcaaaagaggtcctagaagatcttaaagcaaacacaaggtactcagatgatgaactctgcaagtggtatgagagtttcagcaagcagagccccaatggcaaaatcactcgcacagagtttgagaagatctacgccaatttctttcccaattctgatcccaagagctacgccaggcacgtgttccgcagcttcgacaccaatgaagatggtaccttggacttccgggagtacatcattgccctgcatctcacttcttctgggaaaaccagcctcaagctagagtgggcattttccctgtttgatgtagacaagaatggggaaatcagcaaggtcgaagtgcttgaaattattacagcaattttcaagatgatcccaccagaagagcagaagaacctggcagatgatgaaaataccccacaaaaaagagcagacaagctatgggcctacttcaaaaagagtgatgatgcgaaaatcgccgagggagaattcattcagggcattatgatgaacgacgagatcatgagacttattcagtacgacccaagaaaaaaataagcagcgactggtggagggagaagagggggaagcccaagcgaatgccaataaagatcggtgtgtgtttgtgagacttcaatcttctttacattcaagaatacaaggaataaagtctaatgatgtgttggtggcagatcaaagcaccagtgcaacaaacttagccagacaaagcttctggcctatatggcacaaatggttaaaccaatagatgatttatttcagttacagtttattcacatattatgtttcattccctgttatatcaaatgtatgaaataaaaagcctcaaataataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGNTKSGALSKEVLEDLKANTRYSDDELCKWYESFSKQSPNGKITRTEFEKIYANFFPNSDPKSYARHVFRSFDTNEDGTLDFREYIIALHLTSSGKTSLKLEWAFSLFDVDKNGEISKVEVLEIITAIFKMIPPEEQKNLADDENTPQKRADKLWAYFKKSDDAKIAEGEFIQGIMMNDEIMRLIQYDPRKK
Donor tissue: tadpole