ORFeome > MGC79787 – XORFeome 2.0

MGC79787 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC79787 protein, mRNA (cDNA clone MGC:79787 IMAGE:6986012), complete cds
Gene Symbol: MGC79787
Gene ID: 448539
ORF gb_acc: MG133763
ORF ID: 11332

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076707

Library Location

Plate ID: GDExt11013
Well Location: B06

EST Sequences

Clone: MGC:79787 IMAGE:6986012
Trimmed Sequence: ATGACCAACACAAGAGGAAAAAGGCGGGGAACCCGTTATATGTTCTCCAGACCCTTCCGCAAACATGGCGTGGTACCTCTGTCAACGTACATGCGTATCTACAAGAAGGGTGATATTGTGGACATAAAGGGTATGGGCACAATCCAAAAAGGTATGCCCCACAAATGTTACCACGGCAAGACTGGCAGAGTTTACAATGTTACACAGCACGCTGTGGGAATTATTGTGAACAAGCAGATCAAGGGCCGGATCCTTGCCAAGAGAATCAACGTCCGCGTTGAGCACATTCGCCACTCTAAGAGCAGAGACAGCTTCCTGCAGCGCGTGAAGGAGAATGAGAGGAAGAAAAAGGAGGCCAAGGAGAAGGGAATATGGGTGGAGCTTAAACGCCAGCCTGCCCAGCCCAGAGAAGCTCATTTCGTTACGACTGGTGGTGTAGAGCCTCAGCTGCTTGAGCCTATCCCATACGAGTTCATGGCATAA
Full Trace Sequence: cgccatcttccagtaatctgcaaagatgaccaacacaagaggaaaaaggcggggaacccgttatatgttctccagacccttccgcaaacatggcgtggtacctctgtcaacgtacatgcgtatctacaagaagggtgatattgtggacataaagggtatgggcacaatccaaaaaggtatgccccacaaatgttaccacggcaagactggcagagtttacaatgttacacagcacgctgtgggaattattgtgaacaagcagatcaagggccggatccttgccaagagaatcaacgtccgcgttgagcacattcgccactctaagagcagagacagcttcctgcagcgcgtgaaggagaatgagaggaagaaaaaggaggccaaggagaagggaatatgggtggagcttaaacgccagcctgcccagcccagagaagctcatttcgttacgactggtggtgtagagcctcagctgcttgagcctatcccatacgagttcatggcataaatgctattaaaaatatttcttttggaaactgaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTNTRGKRRGTRYMFSRPFRKHGVVPLSTYMRIYKKGDIVDIKGMGTIQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQIKGRILAKRINVRVEHIRHSKSRDSFLQRVKENERKKKEAKEKGIWVELKRQPAQPREAHFVTTGGVEPQLLEPIPYEFMA
Donor tissue: tadpole