ORFeome > MGC88984 – XORFeome 2.0

MGC88984 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC88984 protein, mRNA (cDNA clone MGC:88984 IMAGE:7003844), complete cds
Gene Symbol: MGC88984
Gene ID: 448253
ORF gb_acc: MG134025
ORF ID: 11640

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075317

Library Location

Plate ID: GDExt11016
Well Location: C11

EST Sequences

Clone: MGC:88984 IMAGE:7003844
Trimmed Sequence: ATGTTCGGGATGATAAAGAACTCGCTGTTCGGAGGGGTAGAGAACAATGAAGGGAAACTTGTGAGCAAAGGAGAGAAAGATGGAGTGGCTTTTGAAGAGAGAGAATATGAAGGAGGGAAATTTGTCTCAACAGAAGTGTCTGGGAAACCATTTGATGAAGCCTCAAAAGAAGCTGTTCTGCGGCTCCTAAAATATGTAGGGGGCTCTAACCAAAAGTATGCCGGAATGGGCATGACATCGCCAGTCGTCATCACTAGTTATCCAGCAGAGAATGAGACCTTGCAACCCAATGTAAAGGTCCTGCTCCGAATTCCCAGCCAGTATCAGGCAGACCCCCCAGTCCCTACAGATGACACCATACATATTGAAGACCGTGAGAGTGTAACATTTTATTCCACGCAGTTTGGAGGATACGCCAAAGAAGCAGACTATGTATCCCATGCAGCCAAACTACGTTCTTGTCTTGGTCCAGACATTTCTTATCATACTGACCACTACATGTGCTGTGGCTATGACCCCCCAATGAAACCTTATGGAAGACGTAACGAAGTCTGGTTTATTAAGAACAATTGA
Full Trace Sequence: gaaagagcgagttgtataacacggagctcggttgcactgggagcagtttagcgtgtgagtgggggcagcagggaggggaggccgcagggagcagcacccagtggaacaggcggggcacccacaatacactgacagctgcccgggagatcgccacacacggtgcaagtgcagcacaggcagcgccaagatgttcgggatgataaagaactcgctgttcggaggggtagagaacaatgaagggaaacttgtgagcaaaggagagaaagatggagtggcttttgaagagagagaatatgaaggagggaaatttgtctcaacagaagtgtctgggaaaccatttgatgaagcctcaaaagaagctgttctgcggctcctaaaatatgtagggggctctaaccaaaagtatgccggaatgggcatgacatcgccagtcgtcatcactagttatccagcagagaatgagaccttgcaacccaatgtaaaggtcctgctccgaattcccagccagtatcaggcagaccccccagtccctacagatgacaccatacatattgaagaccgtgagagtgtaacattttattccacgcagtttggaggatacgccaaagaagcagactatgtatcccatgcagccaaactacgttcttgtcttggtccagacatttcttatcatactgaccactacatgtgctgtggctatgaccccccaatgaaaccttatggaagacgtaacgaagtctggtttattaagaacaattgacaacaatttggaacacctgaaatgagaagtttgattcatgaaccaggccagctgtaggctccacaatcccacttgtgatacatacccagtctgatagacccctttgggattttccagaatgtgcagtgcttgacagatgtaatggtaaatgggttgcagggtttttataaagctttgacattagttgcaaacgatatatattataataaaataattttaatgttaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MFGMIKNSLFGGVENNEGKLVSKGEKDGVAFEEREYEGGKFVSTEVSGKPFDEASKEAVLRLLKYVGGSNQKYAGMGMTSPVVITSYPAENETLQPNVKVLLRIPSQYQADPPVPTDDTIHIEDRESVTFYSTQFGGYAKEADYVSHAAKLRSCLGPDISYHTDHYMCCGYDPPMKPYGRRNEVWFIKNN
Donor tissue: