ORFeome > MGC89016 – XORFeome 2.0

MGC89016 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89016 protein, mRNA (cDNA clone MGC:89016 IMAGE:7004672), complete cds
Gene Symbol: MGC89016
Gene ID: 493534
ORF gb_acc: MG134142
ORF ID: 11771

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082490

Library Location

Plate ID: GDExt11017
Well Location: A09

EST Sequences

Clone: MGC:89016 IMAGE:7004672
Trimmed Sequence: ATGTCTGTAATATCACACTTGGTTGTCACTTGTTTACTCTTCGTTGCCTTTTCCAATGGTCTAGAAAGAATAAAACTTCATAGATTCAAATCGGTTGCAAGAACTCTGCATGACGTCGGTTCAGCAGTAGAACATGTCCGCATGAAATATGTTGATAATCATATGAAATCAGCGCCTGAACCGTTGACCAACTATATGGATGTGCAATATTATGGAGTGATTAGCATAGGTACCCCTCCGCAGTCCTTCCGAGTGGTGTTTGATACGGGGTCATCAAATCTCTGGGTGCCATCGAAAAAATGCAAATGGACGGACATTGCATGCTGGCTTCATCGCAAGTACGATTCAAAAAAGTCCTCGACATACAAAGCCAATGGAACCGAGTTTGCAATTCACTATGGCACTGGAAGCTTGACTGGCTTCCTCAGCACAGACACGGTTTCTGTTGGTTCACTGAGCGTCAAATCTCAAACATTCGCCGAAGCCATTACTCAGCCTGGCATAACTTTTGTTGCTGCCAAGTTCGACGGCATCCTCGGCATGGCGTACCCTTCCATCTCAGTGGATGGTGTCGTTCCGGTTTTCAACAACATGGTCAATCAGAAATTGGTTGATCAGGCTATTTTTTCATTTTACCTGTCGAGGGATGCGTCTGCCAAGGAAGGCGGCGAGATCATTCTCGGAGGAAGCGATCCGGATCATTATGTCGGAAACTTCACCTACCTCGATGTCACCAGAAAGGCATATTGGCAAATTAAAATGGACAGCGTGACCGTTTCATCCGAGAGTGAATGCATGAATGCAATGATGGTGGGCGGGGAGTATTGCAAGGGTGGATGCCAAGCAATTGCCGATACCGGAACGTCCTTGATCGTTGGACCTAGCAGTGACGTGGAGAAACTGAATGCAGAAATCGGAGCTCTCCCGATTATTAGCGGGGAATATTGGATAAACTGCAGCAAAATCGCATCCTTGCCGACCATCAATTTTGTTCTCGGTGGAAAGTCTTTCAGTCTCACTGGAAAGGACTATGTCGTAGTTGTAACTCAAATGGGTCAGACGATATGCTTGAGCGGGTTTGTTGCCATGGACATCCCCCCTCCAGCTGGCCCGCTCTGGATTCTCGGCGACATCTTCATCGGTAAATATTACACGGAATTCGACTTGGCCAATAACAGGGTCGGATTCGCTACCGTGAAAACAACCGGCTCAGATTACTTCGGAATTCCAAAATACAACGACCCAAGTTCGTTCGACGACATTTAA
Full Trace Sequence: ccgacttttacaacagtgatcacctcgctggttgttttgttagaatcgaaaggagtgatttttcgagatgtctgtaatatcacacttggttgtcacttgtttactcttcgttgccttttccaatggtctagaaagaataaaacttcatagattcaaatcggttgcaagaactctgcatgacgtcggttcagcagtagaacatgtccgcatgaaatatgttgataatcatatgaaatcagcgcctgaaccgttgaccaactatatggatgtgcaatattatggagtgattagcataggtacccctccgcagtccttccgagtggtgtttgatacggggtcatcaaatctctgggtgccatcgaaaaaatgcaaatggacggacattgcatgctggcttcatcgcaagtacgattcaaaaaagtcctcgacatacaaagccaatggaaccgagtttgcaattcactatggcactggaagcttgactggcttcctcagcacagacacggtttctgttggttcactgagcgtcaaatctcaaacattcgccgaagccattactcagcctggcataacttttgttgctgccaagttcgacggcatcctcggcatggcgtacccttccatctcagtggatggtgtcgttccggttttcaacaacatggtcaatcagaaattggttgatcaggctattttttcattttacctgtcgagggatgcgtctgccaaggaaggcggcgagatcattctcggaggaagcgatccggatcattatgtcggaaacttcacctacctcgatgtcaccagaaaggcatattggcaaattaaaatggacagcgtgaccgtttcatccgagagtgaatgcatgaatgcaatgatggtgggcggggagtattgcaagggtggatgccaagcaattgccgataccggaacgtccttgatcgttggacctagcagtgacgtggagaaactgaatgcagaaatcggagctctcccgattattagcggggaatattggataaactgcagcaaaatcgcatccttgccgaccatcaattttgttctcggtggaaagtctttcagtctcactggaaaggactatgtcgtagttgtaactcaaatgggtcagacgatatgcttgagcgggtttgttgccatggacatcccccctccagctggcccgctctggattctcggcgacatcttcatcggtaaatattacacggaattcgacttggccaataacagggtcggattcgctaccgtgaaaacaaccggctcagattacttcggaattccaaaatacaacgacccaagttcgttcgacgacatttaaacgtctcgacatatgtcaaaacaagtgcatctcttcttgaagttgtcttcatttcattcagatattgtcggactgtgattctaaagtatgtcattagtgtggcttcatttctaactatcactcggggatgcaagattccattcgcataaatcatcgattcgttccgtaataataatggcctgctattcatccacactatttcaaacctgaatgggtactcgaaggtgcaagccaccttacccaactttctccgtatcaatcccattgacacgatctgatcacacggtgtcaagcaccaagtcatcatgttgatagtcgacagcaaattccttattgaagagagctcgaaaatttggactttccttttgcgaacacataggtcagcccgaggcgagcacttgaccgactgatctgccatgtctgttcgaattttgtgtcatattccggttactaaattattttatttcatcatggttttgaacagtatataactgggatttaatatgtttgcattctataacatatgttgtatggattcaaaattgctatgttaggttggtacaggctgcattatccgacatctgttcttgcttctatgttggttgcaaaaatagttgctcatttttacaaacttttaattgattggtttacatatattgtgtgtatgtatgtatgatgttcccattatatttagttagattattttatcgaattagttatcttttaatagtatttattaaatattcgtttgagacctttgcactgacttccgtgaacagttgtttggttttcacacgctggcatttcttgtgggcaccgagactgctatgggtcttcaactcttgcaggcagaattttcttgaatatttaagtttgtttagttatttgatgttatattttgtgaaataaaccatatgtatgtaacagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSVISHLVVTCLLFVAFSNGLERIKLHRFKSVARTLHDVGSAVEHVRMKYVDNHMKSAPEPLTNYMDVQYYGVISIGTPPQSFRVVFDTGSSNLWVPSKKCKWTDIACWLHRKYDSKKSSTYKANGTEFAIHYGTGSLTGFLSTDTVSVGSLSVKSQTFAEAITQPGITFVAAKFDGILGMAYPSISVDGVVPVFNNMVNQKLVDQAIFSFYLSRDASAKEGGEIILGGSDPDHYVGNFTYLDVTRKAYWQIKMDSVTVSSESECMNAMMVGGEYCKGGCQAIADTGTSLIVGPSSDVEKLNAEIGALPIISGEYWINCSKIASLPTINFVLGGKSFSLTGKDYVVVVTQMGQTICLSGFVAMDIPPPAGPLWILGDIFIGKYYTEFDLANNRVGFATVKTTGSDYFGIPKYNDPSSFDDI
Donor tissue: