ORFeome > MGC89038 – XORFeome 2.0

MGC89038 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89038 protein, mRNA (cDNA clone MGC:89038 IMAGE:7005165), complete cds
Gene Symbol: MGC89038
Gene ID: 448571
ORF gb_acc: MG134137
ORF ID: 11765

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076904

Library Location

Plate ID: GDExt11017
Well Location: D03

EST Sequences

Clone: MGC:89038 IMAGE:7005165
Trimmed Sequence: ATGTCTGCCTTGAAGATGGATGAAGAGCAAAGCCTGAATGTGTACATGCAGGAGTTCCGTACAAGGTTTATAAACAGGAGTAGCGAGGAGGTGACAAGCCAGGCGTTGAAGGAGTCCTACAAAGACTCAGCACAAACAGATGCCTGGTTCAAGAAATATAGAGATGGAGAATTAATGATAGAAAAAGTACTGGAGTTCAGAAATGAAATCACTTTGCAGAACAAGCGCATTGAAGAAAAACAAAAGAATATTTTACAAGAAGCTGCCAAACAGGGTGAACATGAGCAGATAAAGGAAGAACTGACTGAACGCATCCAGAGATTAAGGGAAGAGCTCAATAAAAAAAGAGAAGTGGCCTTAGCTAACAGAAAAGCCAATAAGGAAAGAATAAAGGAATTGCAAAAATCTGCAACTTTGTTCAGGGAGCGTCTCGGCCTAGAGATCCGCAAACTGAGGGGTGATAAACTACAGTTTGTCTTCAGATGTATTAACCCGAAAGACCTTGATCAGCCATATTCTTGCATTATTTCTTTAAATGCAGAAGGAGAGTATGAAGTCACAGGGTGTGATCCCCCTTTGGAATGCATTGCTGAATTTCAAGAGAAAGTCAGAGAAACCAGAAACTTCTCCGCTTTACTTGCCAACCTGAGGAAGAGCTTCACTGCGTTGGGCTCTCAAGTGAAATAA
Full Trace Sequence: gttcaaaattaggaaaacaaaagtcgggctcccagcagctgcgctccggggtgggaccagtaagttcaagtaacggcgttgtattcactcggtgaggggaaggcaagtgctcagcgcatacaactgaatgttatgattcaaccatgtctgccttgaagatggatgaagagcaaagcctgaatgtgtacatgcaggagttccgtacaaggtttataaacaggagtagcgaggaggtgacaagccaggcgttgaaggagtcctacaaagactcagcacaaacagatgcctggttcaagaaatatagagatggagaattaatgatagaaaaagtactggagttcagaaatgaaatcactttgcagaacaagcgcattgaagaaaaacaaaagaatattttacaagaagctgccaaacagggtgaacatgagcagataaaggaagaactgactgaacgcatccagagattaagggaagagctcaataaaaaaagagaagtggccttagctaacagaaaagccaataaggaaagaataaaggaattgcaaaaatctgcaactttgttcagggagcgtctcggcctagagatccgcaaactgaggggtgataaactacagtttgtcttcagatgtattaacccgaaagaccttgatcagccatattcttgcattatttctttaaatgcagaaggagagtatgaagtcacagggtgtgatccccctttggaatgcattgctgaatttcaagagaaagtcagagaaaccagaaacttctccgctttacttgccaacctgaggaagagcttcactgcgttgggctctcaagtgaaataagttcagcttttatggtttagctcttaatgtgtatttccacatatgttctgagtgactagcaggaatataaaagcaaaacaaatctgttttccatagactgactgaaacctgcataagcacctgcttcattcagtgttttaaacctatatgtatattatagtctttgtttatttttaatcccattatttaaaccagtaatgaaattcttttctaaaataaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSALKMDEEQSLNVYMQEFRTRFINRSSEEVTSQALKESYKDSAQTDAWFKKYRDGELMIEKVLEFRNEITLQNKRIEEKQKNILQEAAKQGEHEQIKEELTERIQRLREELNKKREVALANRKANKERIKELQKSATLFRERLGLEIRKLRGDKLQFVFRCINPKDLDQPYSCIISLNAEGEYEVTGCDPPLECIAEFQEKVRETRNFSALLANLRKSFTALGSQVK
Donor tissue: