ORFeome > MGC89096 – XORFeome 2.0

MGC89096 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89096 protein, mRNA (cDNA clone MGC:89096 IMAGE:7006401), complete cds
Gene Symbol: MGC89096
Gene ID: 448582
ORF gb_acc: MG134096
ORF ID: 11720

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076916

Library Location

Plate ID: GDExt11017
Well Location: E06

EST Sequences

Clone: MGC:89096 IMAGE:7006401
Trimmed Sequence: ATGTCTAGCATGGAGAAGAATCTGTTCAACCTGAAATTTGCTGCTAAAGAATTGCATCGAAATGCCAAAAAATGTGAAAAAGAAGAAAAAACAGAGAAAGCTAAAATTAAAAAGGCCATTCAGAAGGGCAATACAGAGATAGCAAGAATACATGCAGAGAATGCAATACGACAGAAAAATCAAGGCATTAATTTCTTGAGGATGAGTGCCAGGGTGGATGCTGTGGCAGCAAGGGTTCAGACTGCTGTGACAATGGGCAAGGTAACAAAGTCTATGGCAGGAGTAGTGAAATCTATGGATACTACTCTGAAGAGTATGAACCTAGAAAAGATCTCTGCTTTAATGGACAAATTTGAACACCAGTTTGAGACACTAGATGTGCAGACACAGCAAATGGAAGATACAATGAGTAACACTACCACATTAACCACGCCACAGAATCAAGTGGATAATTTGTTACATGAAATGGCAGATGAAGCAGGTCTTGACTTAAACATGGAATTGCCTCAAGGCCAGACTGGGTCTGTTGGTACCAGTGTAGCATCCACAGAACAGGATGAGCTATCGCAAAGACTGGCCCGTCTGCGTGATCAAGTGTAG
Full Trace Sequence: cggaagagtttgaacttgctttgacaacaagtaacagtgcggattgtggaacaagtcaccggtccggagagaactttggataatgtctagcatggagaagaatctgttcaacctgaaatttgctgctaaagaattgcatcgaaatgccaaaaaatgtgaaaaagaagaaaaaacagagaaagctaaaattaaaaaggccattcagaagggcaatacagagatagcaagaatacatgcagagaatgcaatacgacagaaaaatcaaggcattaatttcttgaggatgagtgccagggtggatgctgtggcagcaagggttcagactgctgtgacaatgggcaaggtaacaaagtctatggcaggagtagtgaaatctatggatactactctgaagagtatgaacctagaaaagatctctgctttaatggacaaatttgaacaccagtttgagacactagatgtgcagacacagcaaatggaagatacaatgagtaacactaccacattaaccacgccacagaatcaagtggataatttgttacatgaaatggcagatgaagcaggtcttgacttaaacatggaattgcctcaaggccagactgggtctgttggtaccagtgtagcatccacagaacaggatgagctatcgcaaagactggcccgtctgcgtgatcaagtgtaggaaagacaccagcttttccataagtgcatttttgcatttcacctgtacatatatgcagtgcatagtttgggatattttcttgtgcgtgtctagaagcataaatggtgatcttgcggcaagatgcttaactggctatctttcaacaattcaacctaatatatataaacctttatggatgctctgaacaagcatatggcatgacattggaatgtctataatgccaatattagaacgtttaatataccaaactacaggacccggttagagatgtacaagcagatcatttgtcttataagcatatttgtgaatggaactttgtgctgtctttgaaagtctttctagtgtgtgactcaaatgacttttcctgtttatcactcttcattttcatctaagaaagctttatatataatttatagtattattgttttcttgcctttacattaaattggttttattgctaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSSMEKNLFNLKFAAKELHRNAKKCEKEEKTEKAKIKKAIQKGNTEIARIHAENAIRQKNQGINFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDTTLKSMNLEKISALMDKFEHQFETLDVQTQQMEDTMSNTTTLTTPQNQVDNLLHEMADEAGLDLNMELPQGQTGSVGTSVASTEQDELSQRLARLRDQV
Donor tissue: