ORFeome > MGC89305 – XORFeome 2.0

MGC89305 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89305 protein, mRNA (cDNA clone MGC:89305 IMAGE:6983379), complete cds
Gene Symbol: MGC89305
Gene ID: 493255
ORF gb_acc: MG133821
ORF ID: 11396

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080133

Library Location

Plate ID: GDExt11013
Well Location: G10

EST Sequences

Clone: MGC:89305 IMAGE:6983379
Trimmed Sequence: ATGGCGGACGACGCCGGTGGTAACAGGGGAGGTTTCCGCGGGGGCTTCGGCAGTGGTGGCCGAGGCCGCGGTCGTGGAAGAGGCAGGGGACGCGGCAGAGGACGTGGGGCCCGTGGCGGGAAAGCAGACGACAAGGAATGGGTGCCAGTCACCAAGCTTGGACGTCTGGTCAAGGACATGAAGATCAAGTCCTTGGAGGAAATCTATCTCTTCTCCCTGCCCATCAAGGAGTCTGAAATCATTGACTTCTTCCTGGGCTCCTCTCTGAAGGACGAGGTGCTGAAGATCATGCCTGTGCAGAAACAGACCCGTGCCGGGCAGCGAACTAGGTTCAAGGCTTTTGTGGCTATCGGTGACTACAACGGTCACGTTGGTCTCGGTGTGAAATGCTCCAAAGAAGTGGCCACCGCCATCCGTGGAGCAATCATCCTGGCCAAACTGTCCATCGTTCCTGTTCGTAGAGGTTACTGGGGTAACAAGATCGGCAAGCCCCACACTGTGCCCTGCAAGGTGACTGGTCGCTGTGGTTCTGTGCTGGTGCGTCTGATCCCTGCCCCCAGAGGTACCGGTATTGTGTCTGCTCCTGTCCCCAAGAAGCTGCTGATGATGGCTGGTATTGATGACTGCTACACATCAGCCAGGGGCTGCACTGCCACCTTGGGTAACTTCGCTAAAGCCACCTTTGATGCCATCTCAAAGACTTACAGCTATCTGACTCCTGACCTCTGGAAGGAGACTGTGTTCACCAAATCTCCATACCAGGAGTACACTGACCATCTGGCCAAGACTCACACCCGGGTGTCCGTGCAGAGGACCCAGGCTGCTGCTGTTCCTGCCACCTCCTAA
Full Trace Sequence: gaaatcaccaaatggcggacgacgccggtggtaacaggggaggtttccgcgggggcttcggcagtggtggccgaggccgcggtcgtggaagaggcaggggacgcggcagaggacgtggggcccgtggcgggaaagcagacgacaaggaatgggtgccagtcaccaagcttggacgtctggtcaaggacatgaagatcaagtccttggaggaaatctatctcttctccctgcccatcaaggagtctgaaatcattgacttcttcctgggctcctctctgaaggacgaggtgctgaagatcatgcctgtgcagaaacagacccgtgccgggcagcgaactaggttcaaggcttttgtggctatcggtgactacaacggtcacgttggtctcggtgtgaaatgctccaaagaagtggccaccgccatccgtggagcaatcatcctggccaaactgtccatcgttcctgttcgtagaggttactggggtaacaagatcggcaagccccacactgtgccctgcaaggtgactggtcgctgtggttctgtgctggtgcgtctgatccctgcccccagaggtaccggtattgtgtctgctcctgtccccaagaagctgctgatgatggctggtattgatgactgctacacatcagccaggggctgcactgccaccttgggtaacttcgctaaagccacctttgatgccatctcaaagacttacagctatctgactcctgacctctggaaggagactgtgttcaccaaatctccataccaggagtacactgaccatctggccaagactcacacccgggtgtccgtgcagaggacccaggctgctgctgttcctgccacctcctaattttttttctgttaaagaaaaataaaaagtaaaaccttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MADDAGGNRGGFRGGFGSGGRGRGRGRGRGRGRGRGARGGKADDKEWVPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEYTDHLAKTHTRVSVQRTQAAAVPATS
Donor tissue: tadpole