ORFeome > MGC89662 – XORFeome 2.0

MGC89662 – XORFeome 2.0

General Information

Species: Xenopus tropicalis small nuclear ribonucleoprotein polypeptide F, mRNA (cDNA clone MGC:89662 IMAGE:7026112), complete cds
Gene Symbol: MGC89662
Gene ID: 448659
ORF gb_acc: MG133104
ORF ID: 10531

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077006

Library Location

Plate ID: GDExt11005
Well Location: A07

EST Sequences

Clone: MGC:89662 IMAGE:7026112
Trimmed Sequence: ATGAGTTTACCACTGAATCCAAAACCCTTCCTTAATGGCCTCACTGGTAAGCCAGTTATGGTAAAGCTGAAATGGGGGATGGAGTACAAAGGCTACTTGGTATCAGTGGATGGATACATGAACATGCAGCTTGCAAACACAGAAGAATATATTGATGGTGCATTGTCTGGACATCTTGGAGAAGTTTTGATAAGATGCAACAATGTGTTATATATACGTGGGGTAGAAGAGGAGGAGGAAGATGGAGAGATGAGAGAGTAA
Full Trace Sequence: ttttttttctcctgtcgcttccgggccttggcagccatttcccgctttgctccagcggtgtgttctacgggacgctccggggaggaattttttttattgatctgcagtttgttgtgaggctgcggtcgcaccatgagtttaccactgaatccaaaacccttccttaatggcctcactggtaagccagttatggtaaagctgaaatgggggatggagtacaaaggctacttggtatcagtggatggatacatgaacatgcagcttgcaaacacagaagaatatattgatggtgcattgtctggacatcttggagaagttttgataagatgcaacaatgtgttatatatacgtggggtagaagaggaggaggaagatggagagatgagagagtaattggaattatttggaaatccctttgtatagtttcatgaagaaaaggataacttcatttattatgaaggcattttttttacagcatttttcttttttttatagttgtttacactgcattcagtgtttgttctttattgtgttagaacaataaaagataattgcattgcaaaaaaaaaaaaaaaa
Translation: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE
Donor tissue: