ORFeome > MGC89669 – XORFeome 2.0

MGC89669 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89669 protein, mRNA (cDNA clone MGC:89669 IMAGE:7026217), complete cds
Gene Symbol: MGC89669
Gene ID: 448661
ORF gb_acc: MG133081
ORF ID: 10498

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077009

Library Location

Plate ID: GDExt11005
Well Location: G08

EST Sequences

Clone: MGC:89669 IMAGE:7026217
Trimmed Sequence: ATGATGCCGTCACGCAACAACGCAGCATCAGGAATACCAAACAGTAAAGTGAAGTACTCCAAGCTCTCTGATACAGATGATGGATACATTGACCTTCAGTTTAAGAAGAGCCCTCCAAAAATCCCATACAAAGCCATTGCTCTGGCAACAGTGCTGTTCTTAATTGGTACTCTACTCATTGTCATTGGGTCTCTGCTTTTAGCCGGATATATCAGCCCTGGGGGAAATGAACGAGCAATCCCAGTCCTGATTATTGGCATACTGGTTTTCCTGCCTGGCTTTTATCATCTGCGCATTGCGTACTATGCCTCCAAAGGGTATCGAGGTTACTCCTACGACGATATTCCAGATTTTGATGACTGA
Full Trace Sequence: ccgctggtgttgctgacgcacagcctgccgggataatccgagcccccgtaccatgggcgccggtatgaggttgtagtttttgtgtatcccatgacaagccatctctgccatgatgccgtcacgcaacaacgcagcatcaggaataccaaacagtaaagtgaagtactccaagctctctgatacagatgatggatacattgaccttcagtttaagaagagccctccaaaaatcccatacaaagccattgctctggcaacagtgctgttcttaattggtactctactcattgtcattgggtctctgcttttagccggatatatcagccctgggggaaatgaacgagcaatcccagtcctgattattggcatactggttttcctgcctggcttttatcatctgcgcattgcgtactatgcctccaaagggtatcgaggttactcctacgacgatattccagattttgatgactgataatccaacgtacattgtgtggattaggacattgctgtgccctagtaggagtagacttactttaagagagaccagttaatgcagaggacacatattgcataggtctaagaatttgtttgtaagcaacaacatgagggttcccggccctagatttactcttagttaaaaatcagagcaaaataaacaggttgtggggcaattggcacgaaccaatcaactggcaggaggtttctgacttaacatagttctgtatgaaaatacttggaaaagtttcagatgaatgagggtaaattggtggaaatcattattctgccatactaattactatataaatcaattgcaaatgcagtttttattacattacatttttaaggggaaataataccctgtttataatgtttattgtatttttcctaaaaaggacagggaaaggtatttggtgtgcacaggacattccttatttgcatgttaaattccctttgatttgtaatattactgtactgtaaagatgtatagccatgcttgtagtatagcactttataaataaaaatacagtataagtaaaaaaaaaaaaaaaa
Translation: MMPSRNNAASGIPNSKVKYSKLSDTDDGYIDLQFKKSPPKIPYKAIALATVLFLIGTLLIVIGSLLLAGYISPGGNERAIPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Donor tissue: