ORFeome > MGC89679 – XORFeome 2.0

MGC89679 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ubiquitin A-52 residue ribosomal protein fusion product 1, mRNA (cDNA clone MGC:89679 IMAGE:7026325), complete cds
Gene Symbol: MGC89679
Gene ID: 448705
ORF gb_acc: MG133059
ORF ID: 10467

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077658

Library Location

Plate ID: GDExt11005
Well Location: B04

EST Sequences

Clone: MGC:89679 IMAGE:7026325
Trimmed Sequence: ATGCAAATCTTTGTTAAAACCCTTACTGGGAAAACAATCACCCTTGAGGTTGAGCCCAGTGATACTATTGAAAATGTGAAGGCCAAAATCCAGGACAAGGAAGGTATTCCCCCTGACCAACAGCGTCTGATCTTTGCTGGTAAACAACTTGAAGATGGACGCACCCTATCTGATTATAACATCCAGAAAGAGTCCACTTTGCATCTGGTGTTGCGTCTGCGTGGTGGTATCATTGAGCCTTCCCTTCGCCAACTTGCTCAGAAGTACAACTGTGACAAAATGATTTGCCGCAAGTGCTATGCCCGCCTTCACCCTCGTGCTGTAAATTGCCGTAAGAAGAAGTGTGGTCACACCAATAACCTGCGTCCCAAGAAGAAGGTCAAATAA
Full Trace Sequence: cttttctaatcagtcggccgccgtgcggtaaacgggaagatgcaaatctttgttaaaacccttactgggaaaacaatcacccttgaggttgagcccagtgatactattgaaaatgtgaaggccaaaatccaggacaaggaaggtattccccctgaccaacagcgtctgatctttgctggtaaacaacttgaagatggacgcaccctatctgattataacatccagaaagagtccactttgcatctggtgttgcgtctgcgtggtggtatcattgagccttcccttcgccaacttgctcagaagtacaactgtgacaaaatgatttgccgcaagtgctatgcccgccttcaccctcgtgctgtaaattgccgtaagaagaagtgtggtcacaccaataacctgcgtcccaagaagaaggtcaaataaactgacctttgcatctattttgattgttgataacaaataaaaaaaaaacagaagacaaaaaaaaaaaaaaaa
Translation: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK
Donor tissue: