ORFeome > MGC89715 – XORFeome 2.0

MGC89715 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89715 protein, mRNA (cDNA clone MGC:89715 IMAGE:7026873), complete cds
Gene Symbol: MGC89715
Gene ID: 493328
ORF gb_acc: MG133102
ORF ID: 10526

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080461

Library Location

Plate ID: GDExt11005
Well Location: G03

EST Sequences

Clone: MGC:89715 IMAGE:7026873
Trimmed Sequence: ATGTTTCCCGAGCTAAACAGCCTGCTGGGAGCCGGCACTGATACAGTGGAACGGGGCAAATTTACTCTCCTCTGTGACTCCAAGACCGATGGGAGCTTCCTGGTCCATCACTTCCTGTCCTACTACCTGAGGGCGGGGTGCAGGGTGTGCTTTGTGGCCCTGGTGCAGTCATTCAGTCACTACAGCATCGTTGCCCAGAAGCTGGGAGTGAACCTGAGCTCGGCTAAGGACGAGGGGCAACTGGTGTTCCTGGAAGGGCTGAGATCGTACACGGACTTGCTCTTTGGTGACAATCCGGAGGCAGAAGTAACCAACCCTCTCTGTTTCCTAAGGGCAGGATCAGACCTGAAACCTTTATACAGCTTTGTTAGTGCTGCACTGGCGCCATCTGCTGGTCAGTCGTGGAAGTGTCCTGTGCTGATCCTGGATGATGTGAGTGTCCTGCTCAGTCTGGGGGTGCCCCCCCTGCAGCTGCTGGACTTCATGCATTACTGCAGGGCCACTGTGTGCACTCAGTACCAGGGTAACGTGGTCTGCCTGGTGCATGGAGCGGAGGAGTCGGGGGATGAGGAGAAGGAGCTGCTGCGGAGGTCTCTGTCCCACCAGAGCCAAGTGATCCTGTGGGCGGAAGGGCTGAGCTCGGGGTTCTGTAAGGAGGTACATGGGCAGCTGAAGATTTTCAGGGGGGCCGTGTCCAGTGGGAAAAAACGGGGGCAAACCCAGCCGGAGATCTACCAGTACAAGATCCAGGACAAACACGTCACGTTTTTCGCCAGAGGGCTGTCGGCGGCTGTGCTCTGA
Full Trace Sequence: gtgcttgtcagacatgtctgccttcggccgctagttacttagttgaactaatacctgtacccacagatactactgataataataataataagcacatttaatggtgagttattgcgcctcaaactgcttcactgacgcggaagccgtactcctgccgcgaaaccatctccatgacaaccaggtgtggcgggttcctggcggcctagtgtcctgtagcgacagtgagagaagagcggggattggaggatgtttcccgagctaaacagcctgctgggagccggcactgatacagtggaacggggcaaatttactctcctctgtgactccaagaccgatgggagcttcctggtccatcacttcctgtcctactacctgagggcggggtgcagggtgtgctttgtggccctggtgcagtcattcagtcactacagcatcgttgcccagaagctgggagtgaacctgagctcggctaaggacgaggggcaactggtgttcctggaagggctgagatcgtacacggacttgctctttggtgacaatccggaggcagaagtaaccaaccctctctgtttcctaagggcaggatcagacctgaaacctttatacagctttgttagtgctgcactggcgccatctgctggtcagtcgtggaagtgtcctgtgctgatcctggatgatgtgagtgtcctgctcagtctgggggtgccccccctgcagctgctggacttcatgcattactgcagggccactgtgtgcactcagtaccagggtaacgtggtctgcctggtgcatggagcggaggagtcgggggatgaggagaaggagctgctgcggaggtctctgtcccaccagagccaagtgatcctgtgggcggaagggctgagctcggggttctgtaaggaggtacatgggcagctgaagattttcaggggggccgtgtccagtgggaaaaaacgggggcaaacccagccggagatctaccagtacaagatccaggacaaacacgtcacgtttttcgccagagggctgtcggcggctgtgctctgagtgagccccaagggctgctgggattgggactgtgctggcagagtgctccccctgctggttatgtatggtacgtgccttgtacatgcgtgtcctgctcctattggcctgggtagggtcagctgacccacagccacacagtacagatccagttctctgcctgcaggaagtgcaagataaatacgcccaggcctagagtgtcagcccccgcgtaccggccaggccttcctttcctttaggcccactagagtgtcagcccccgcgtaccggccaggccttcctttcctttaggcccactagagtgtcagcccccgcgtaccggccaggccttcctttccttttggcccactagagtgtcggcccccgcgtaccggccaggccttcctttcctttaggcccactagagtgtcagcccccgcgtaccggccaggccttcctttcctttaggcccccggcaccggtctgagtgggcagtgttactaaattcatacacttttgcccttgttttataaaaatgcccaggtcaccctagtagttggctccatcatggtggcactggaagcccattggccggcacccacactgaggggcttatttacaatgttggttagatgcgaacttgcatgttactgcaaatactattttgctgaaaatgtataatttgtaatgtgtttctgagcatttgggattattccaacctgcctataaactatttcactaaaaaaaaaaaaaaaa
Translation: MFPELNSLLGAGTDTVERGKFTLLCDSKTDGSFLVHHFLSYYLRAGCRVCFVALVQSFSHYSIVAQKLGVNLSSAKDEGQLVFLEGLRSYTDLLFGDNPEAEVTNPLCFLRAGSDLKPLYSFVSAALAPSAGQSWKCPVLILDDVSVLLSLGVPPLQLLDFMHYCRATVCTQYQGNVVCLVHGAEESGDEEKELLRRSLSHQSQVILWAEGLSSGFCKEVHGQLKIFRGAVSSGKKRGQTQPEIYQYKIQDKHVTFFARGLSAAVL
Donor tissue: