ORFeome > MGC89719 – XORFeome 2.0

MGC89719 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89719 protein, mRNA (cDNA clone MGC:89719 IMAGE:7026891), complete cds
Gene Symbol: MGC89719
Gene ID: 493329
ORF gb_acc: MG133092
ORF ID: 10513

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080462

Library Location

Plate ID: GDExt11005
Well Location: A03

EST Sequences

Clone: MGC:89719 IMAGE:7026891
Trimmed Sequence: ATGCTGCCAAATACAGGAAAGCTAGCTGGTTGCACTCTGTTTATAACTGGAGCAAGTCGTGGTATTGGCAAAGCCATTGCATTAAAGGCTGCCAGGGATGGAGCAAACGTTGTTATAGCAGCCAAGACAGCAGAAGCTCACCCTAAGCTTCCGGGCACAATTTATACTGCAGCTAGTGAAATTGAAGCAGCCGGAGGAAAGGCATTACCGTGCATTGTGGATGTTAGAGATGAGAACCAAATCAGTGCAGCAGTGGAAAAAGCTGTGGATACATTTGGAGGAATAGACATCTTGGTGAATAATGCTAGTGCTATCAGTCTGACCAACACCTTGGAAACACCCATGAAGAAAGTGGATCTTATGATGGGGATCAACACAAGAGGCACATATCTCACATCAAAAATATGCATCCCATACTTGAAAAAAAGCAAAGTGGCCCATATCCTAAATCTTAGCCCTCCATTAAACCTCAACCCAATCTGGTTCAAAAACCACTGCGCTTACACCATAGCAAAATATGGCATGTCTATGTGTGCGCTGGGAATGTCTGAGGAATATAAAGGAGAAATCGCCGTCAATGCTTTGTGGCCAAAAACAGCCATACATACAGCTGCTATGGACATGCTTGGAGGATCGGGAGTGGATAAACAGTGCAGGACTCCAGACATTATGGCTGATGCTGCCTATGCCATTTTGTCAAAGCCAAAGGATTTCACTGGGAACTTTGTCATTGATGAGGAGCTGCTCAAGCACGAGGGAATCAAGGACCTTGATGTCTACGCTGTTAGTCCTGGACACCCATTGCTTCCAGATTTCTTCTTAGATGAGAGCCCAGAGGCACTAGCCAGTGCAATGGAAGAACATGGTGCCACTGCTGCATTTAAGGCAGGAAAAGCACAGGCAAAATCGCAAGACTCTAGCCCCCTGCAAGAGACATTTAAAGCCATTGAGAGTTTAGTCAATGAAGAGGCTGTGAAAACTACTCAAGGCATCTACCAATTTGTACTGTCTGGTGAAGAAAGCGGCAACTGGTTCCTGGACCTGAAGAATGGTAAAGGAGGAGTGGGTAGTGGAGAACCATCAACTAAAGCTGATGTGGTGATGAGCATGGACAGTGGGGACTTCATCAAAATGTTTACAGGCAAGATGAAGCCTACCATGGCATTTATGAGTGGGAAGCTGAAGATAAAAGGAGACATGGGCCTGGCTTTAAAGCTGGAAAAAATTTTAGGCCAGATGAATGCAAAGTTATAA
Full Trace Sequence: ggtgtgtgttaaggagcttggggattcttcatgtcaatgagaatttaagtgtataaaagaacagaaacaaagctgctggcaatttgcacttattgccaaaaccaggtttggaaccaagtgtgccttttttagtccttcactatgctgccaaatacaggaaagctagctggttgcactctgtttataactggagcaagtcgtggtattggcaaagccattgcattaaaggctgccagggatggagcaaacgttgttatagcagccaagacagcagaagctcaccctaagcttccgggcacaatttatactgcagctagtgaaattgaagcagccggaggaaaggcattaccgtgcattgtggatgttagagatgagaaccaaatcagtgcagcagtggaaaaagctgtggatacatttggaggaatagacatcttggtgaataatgctagtgctatcagtctgaccaacaccttggaaacacccatgaagaaagtggatcttatgatggggatcaacacaagaggcacatatctcacatcaaaaatatgcatcccatacttgaaaaaaagcaaagtggcccatatcctaaatcttagccctccattaaacctcaacccaatctggttcaaaaaccactgcgcttacaccatagcaaaatatggcatgtctatgtgtgcgctgggaatgtctgaggaatataaaggagaaatcgccgtcaatgctttgtggccaaaaacagccatacatacagctgctatggacatgcttggaggatcgggagtggataaacagtgcaggactccagacattatggctgatgctgcctatgccattttgtcaaagccaaaggatttcactgggaactttgtcattgatgaggagctgctcaagcacgagggaatcaaggaccttgatgtctacgctgttagtcctggacacccattgcttccagatttcttcttagatgagagcccagaggcactagccagtgcaatggaagaacatggtgccactgctgcatttaaggcaggaaaagcacaggcaaaatcgcaagactctagccccctgcaagagacatttaaagccattgagagtttagtcaatgaagaggctgtgaaaactactcaaggcatctaccaatttgtactgtctggtgaagaaagcggcaactggttcctggacctgaagaatggtaaaggaggagtgggtagtggagaaccatcaactaaagctgatgtggtgatgagcatggacagtggggacttcatcaaaatgtttacaggcaagatgaagcctaccatggcatttatgagtgggaagctgaagataaaaggagacatgggcctggctttaaagctggaaaaaattttaggccagatgaatgcaaagttataaccacttaagagttaagcactggatctatcttgcaaatcctaacagcaaaaggaaatgtacccaccaagccaacagatcaagcggagttcccaatgaccctttcatacattatgagcaactgacagtttattagaaaccaataaaacaactgtgataacatgactgaatgtaacaaagtgcagacccgtacattgcttttcactgcagtgatccctggcacaaatggtagaaaataagaaatattctgtgactttaatactgatgtgtgaaataactaattcttcttttcaaatcaaagaaaataaaaacactgcagatctgaaaaaaaaaaaaaaaa
Translation: MLPNTGKLAGCTLFITGASRGIGKAIALKAARDGANVVIAAKTAEAHPKLPGTIYTAASEIEAAGGKALPCIVDVRDENQISAAVEKAVDTFGGIDILVNNASAISLTNTLETPMKKVDLMMGINTRGTYLTSKICIPYLKKSKVAHILNLSPPLNLNPIWFKNHCAYTIAKYGMSMCALGMSEEYKGEIAVNALWPKTAIHTAAMDMLGGSGVDKQCRTPDIMADAAYAILSKPKDFTGNFVIDEELLKHEGIKDLDVYAVSPGHPLLPDFFLDESPEALASAMEEHGATAAFKAGKAQAKSQDSSPLQETFKAIESLVNEEAVKTTQGIYQFVLSGEESGNWFLDLKNGKGGVGSGEPSTKADVVMSMDSGDFIKMFTGKMKPTMAFMSGKLKIKGDMGLALKLEKILGQMNAKL
Donor tissue: