ORFeome > MGC89748 – XORFeome 2.0

MGC89748 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89748 protein, mRNA (cDNA clone MGC:89748 IMAGE:7027295), complete cds
Gene Symbol: MGC89748
Gene ID: 448710
ORF gb_acc: MG133050
ORF ID: 10454

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077664

Library Location

Plate ID: GDExt11005
Well Location: D03

EST Sequences

Clone: MGC:89748 IMAGE:7027295
Trimmed Sequence: ATGAGTCTCCTTAACAAGCCCAAAAGTGAGATGACACCTGAAGAGCTACAAAAGCGAGAAGAGGAGGAGTTCAACACAGGGCCACTGTCTGTGCTTACTCAGTCTGTGAAGAACAACACACAAGTTCTGATCAACTGCAGGAATAACAAAAAGTTGCTAGGCAGAGTAAAAGCATTTGACAGACACTGTAACATGGTACTGGAAAATGTGAAAGAAATGTGGACTGAGGTCCCTAAGAGTGGCAAGGGAAAAAAGAAGTCCAAACCAGTGAACAAAGACAGATATATTTCCAAGATGTTCCTTCGTGGAGACAGTGTCATCGTTGTTCTGCGGAATCCACTGCTTGCTGGAAAGTGA
Full Trace Sequence: gagtggtccttcaaaggaagcgttctacacgccgggaaaacgtgagaagggaaaggaaagacaaaaagaaagatgagtctccttaacaagcccaaaagtgagatgacacctgaagagctacaaaagcgagaagaggaggagttcaacacagggccactgtctgtgcttactcagtctgtgaagaacaacacacaagttctgatcaactgcaggaataacaaaaagttgctaggcagagtaaaagcatttgacagacactgtaacatggtactggaaaatgtgaaagaaatgtggactgaggtccctaagagtggcaagggaaaaaagaagtccaaaccagtgaacaaagacagatatatttccaagatgttccttcgtggagacagtgtcatcgttgttctgcggaatccactgcttgctggaaagtgataatgtgtagcctctttctaaatttccttgttctggacaaattccaaccctggcatcaaatagttttaatttctttactgaggatcagcaaatgtcgttttttttttttttttttttttcctgtccccttcccccccccccgccaaaaaatacttgtagactgtcacaaaggttgttctttaacaccttttgtcccttccaccattattttttttctaataaagataatttgttaaaacaaaaaaaaaaaaaaaa
Translation: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLLAGK
Donor tissue: