ORFeome > MGC89771 – XORFeome 2.0

MGC89771 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89771 protein, mRNA (cDNA clone MGC:89771 IMAGE:7027658), complete cds
Gene Symbol: MGC89771
Gene ID: 448668
ORF gb_acc: MG133173
ORF ID: 10628

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077019

Library Location

Plate ID: GDExt11006
Well Location: F04

EST Sequences

Clone: MGC:89771 IMAGE:7027658
Trimmed Sequence: ATGCTGCGGCAGGACAGCAATGACGAGACAGAAGACGTTTCCCTGTTTGATGCTGAAGACGAAGGAACTAGGGCTGCAAAGAAGAAGAAGATAAGGCACCCCATCGCTTCCTTCTTCCATCTGTTTTTTCGGATCAGCGCAGTCCTGGTGTACATGCTCTCTGGGTTTAGCAGCAGTTTCATTGCCTGCATGGTGACCATCATATTACTCTTGTCCTGTGACTTCTGGGTTGTGAAGAACATAACAGGGAGGCTGATGGTGGGCCTGCGGTGGTGGAACCAGGTGGATGATGACGGGAAGAGTCATTGGGTGTATGAATCCAGGAAGGCAGCTCAAGGAAAGAAATCCAACTCCGAAGCAGAATCCCGAATCTTCTGGTTGGGGCTCATCTCCTGCCCCATCATTTGGGTCATCTTCGCCTTCAGCTCCCTCTTATCCTTCAACTTGAAATGGCTGGCTGTAGTTATCATGGGGGTAACACTGCAGGGGGCAAATCTGTATGGATATATCAAGTGCAAAGTTGGAAGTCGCAAGAATCTCGGCAGCATCGCTACCAATTACTTCGGCACCCAGTTCCTCAGACAGACCTTTTCCAGAGAGAACCCAGCAGAATCTTGA
Full Trace Sequence: gaagtgagctggtgaagattccggaagaagggagagaatgctgcggcaggacagcaatgacgagacagaagacgtttccctgtttgatgctgaagacgaaggaactagggctgcaaagaagaagaagataaggcaccccatcgcttccttcttccatctgttttttcggatcagcgcagtcctggtgtacatgctctctgggtttagcagcagtttcattgcctgcatggtgaccatcatattactcttgtcctgtgacttctgggttgtgaagaacataacagggaggctgatggtgggcctgcggtggtggaaccaggtggatgatgacgggaagagtcattgggtgtatgaatccaggaaggcagctcaaggaaagaaatccaactccgaagcagaatcccgaatcttctggttggggctcatctcctgccccatcatttgggtcatcttcgccttcagctccctcttatccttcaacttgaaatggctggctgtagttatcatgggggtaacactgcagggggcaaatctgtatggatatatcaagtgcaaagttggaagtcgcaagaatctcggcagcatcgctaccaattacttcggcacccagttcctcagacagaccttttccagagagaacccagcagaatcttgaaccccgttccctacccggatttttcgctgacaaataattggggatgagaatttttgagcaaaacggagatctgaaatcttcctattaatttgtttttttttctgctgctttttctgattgcagtttgtaaggttcatactgggggggggtgggggtgttggacaaaccacggacaatgagggggacccggcctactcctgtgtgatgggccgaaaagaaattaacactaatctgctgccccggccttaataagtcactgggaacatttcatctgctaaaagcacaacttctgttatgtctttgttccttggcgcggcgtgtaaatatgtatttatgggtacagggggtgcaacacttcattatggagagtgggaaataaaggctatttcctcaaaaaaaagaaaaaaaaaaaaaaaa
Translation: MLRQDSNDETEDVSLFDAEDEGTRAAKKKKIRHPIASFFHLFFRISAVLVYMLSGFSSSFIACMVTIILLLSCDFWVVKNITGRLMVGLRWWNQVDDDGKSHWVYESRKAAQGKKSNSEAESRIFWLGLISCPIIWVIFAFSSLLSFNLKWLAVVIMGVTLQGANLYGYIKCKVGSRKNLGSIATNYFGTQFLRQTFSRENPAES
Donor tissue: