ORFeome > MGC89782 – XORFeome 2.0

MGC89782 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89782 protein, mRNA (cDNA clone MGC:89782 IMAGE:7027782), complete cds
Gene Symbol: MGC89782
Gene ID: 448714
ORF gb_acc: MG133180
ORF ID: 10638

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077669

Library Location

Plate ID: GDExt11006
Well Location: C03

EST Sequences

Clone: MGC:89782 IMAGE:7027782
Trimmed Sequence: ATGATAAAAGCGATCCTCATCTTCAACAACCATGGCAAGCCCCGGCTATGCAAGTTCTACCAGCACTATAGCGAAGACACACAACAACAGATTATAAGAGAAACTTTCCACCTTGTATCCAAAAGAGATGAAAATGTTTGCAACTTCTTAGAAGGAGGCTTATTAATAGGTGGATCTGACAACAAACTCATATATCGGCATTATGCTACCTTATATTTTGTTTTTTGCGTGGATTCTTCCGAAAGTGAACTTGGCATTCTAGATCTTATACAAGTGTTTGTAGAAACACTGGATAAATGCTTTGAAAATGTGTGTGAGCTGGATTTAATATTCCATGTCGACAAGGTTCACAACATCCTTGCAGAAATGGTGATGGGAGGTATGGTACTAGAAACTAATATGAATGAAATTGTCACTCAAATTGATGCATAG
Full Trace Sequence: tggtgctggtatcgatgtgagggcgacgttctaatgcgcagccctggagaccgagcccgggcataaggacccgtgtgtgaggcgagcattaaacttccggttaccggtgcccgagtgctgacactgtacctgccccgctggtctctggcagtgcctgctacgcagcatcatgataaaagcgatcctcatcttcaacaaccatggcaagccccggctatgcaagttctaccagcactatagcgaagacacacaacaacagattataagagaaactttccaccttgtatccaaaagagatgaaaatgtttgcaacttcttagaaggaggcttattaataggtggatctgacaacaaactcatatatcggcattatgctaccttatattttgttttttgcgtggattcttccgaaagtgaacttggcattctagatcttatacaagtgtttgtagaaacactggataaatgctttgaaaatgtgtgtgagctggatttaatattccatgtcgacaaggttcacaacatccttgcagaaatggtgatgggaggtatggtactagaaactaatatgaatgaaattgtcactcaaattgatgcatagacaaagctggaaaagtcagaggctggcttagcaggagcgccggcccgggctgtgtctgccgtaaagaatatgaatcttcctgagatcccaagaaacattaacattggtgatatcagtataaaagtgccaaacctgccatcttttaaataagatcattccctttacttgaatttgataaaacgtttacgaaatcaatgtggatagcggttttctattccataaaactgaaggatctgtatagactgtttgcgatatatctgaagtgttggactcagctagatgttgctgttaatactgctaaggctagctcaacctgactccagaattacattcctacgcccctgtaaggcatgtcctatgtcttggctgctcccatttccacagaaagtatttccaatgtctcttcgttgttccgtttacatagttgaagaattccattagataatctgaaaattccttattctattatgtttctattatgttttctcttttactcaacataagacacaaaaatccactttttaaagtatcatttgagattgaacatgaacacagttgtttttaatatcgttatctaggaacttcatgatatagctgttttaacactgtaaaacatattgagatggaatgtcgtggtgtagtattctgtaaaataaatattttatgactgaaaaaaaaaaaaaaaa
Translation: MIKAILIFNNHGKPRLCKFYQHYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDA
Donor tissue: