ORFeome > MGC89837 – XORFeome 2.0

MGC89837 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89837 protein, mRNA (cDNA clone MGC:89837 IMAGE:7028743), complete cds
Gene Symbol: MGC89837
Gene ID: 448716
ORF gb_acc: MG133156
ORF ID: 10600

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077672

Library Location

Plate ID: GDExt11006
Well Location: C01

EST Sequences

Clone: MGC:89837 IMAGE:7028743
Trimmed Sequence: ATGGCTAAGACAGCAATAGCCTACAAGGAAAAGATGAAGGAGCTGTCCATGCTGTCTCTGATCTGTTCTTGTTTTTACCCTGAGCCCCGCAATATCAGCGCATATACATATGATGACATGGAAGTCAAGCAGATTAACAAGCGCGCGTCTGGCCAGGCTTTCGAACTGATATTGAAGCCGCCATCTCCAGTCTCTGAAGCGCCCCGAACCCTGGCCTCTCCCAAGAAGAAGGACGTTTCTCTAGAAGAGATTCAGGCCAAGCTGGAAGCAGCAGAGGACAGACGAAAGTCTCAGGAAGCCCAAGTCCTGAAGCAACTTGCAGACAAGCGGGAGCACGAGAGAGAAGTGCTCCAGAAGGCCCTGGAAGAGAATAACAACTTCAGCAGGCTGGCAGAGGAGAAACTTATACTAAAAATGGAACAGATAAAAGAAAACCGTGAATACTACTTAGCTACCCTCATGGAACGTCTCAAGGAGAAGGAGAGGCATGCCGTCGAAGTGCGCAGAAACAAGGAACAACTAGAACTTTCCGGCTGA
Full Trace Sequence: cgagtgccttattcagtcttttctccctctccactgctgtagctggttccttcgcattcacagcctctgagcatctcttcccagcaccatggctaagacagcaatagcctacaaggaaaagatgaaggagctgtccatgctgtctctgatctgttcttgtttttaccctgagccccgcaatatcagcgcatatacatatgatgacatggaagtcaagcagattaacaagcgcgcgtctggccaggctttcgaactgatattgaagccgccatctccagtctctgaagcgccccgaaccctggcctctcccaagaagaaggacgtttctctagaagagattcaggccaagctggaagcagcagaggacagacgaaagtctcaggaagcccaagtcctgaagcaacttgcagacaagcgggagcacgagagagaagtgctccagaaggccctggaagagaataacaacttcagcaggctggcagaggagaaacttatactaaaaatggaacagataaaagaaaaccgtgaatactacttagctaccctcatggaacgtctcaaggagaaggagaggcatgccgtcgaagtgcgcagaaacaaggaacaactagaactttccggctgaaaaaacataccatcattagtaacttccttgcctatataattacggatcatgcgatatcagtatggaaaacaatgtatgacatcaaaaaaacaaaaaaaaaaaaaaaa
Translation: MAKTAIAYKEKMKELSMLSLICSCFYPEPRNISAYTYDDMEVKQINKRASGQAFELILKPPSPVSEAPRTLASPKKKDVSLEEIQAKLEAAEDRRKSQEAQVLKQLADKREHEREVLQKALEENNNFSRLAEEKLILKMEQIKENREYYLATLMERLKEKERHAVEVRRNKEQLELSG
Donor tissue: