ORFeome > MGC89869 – XORFeome 2.0

MGC89869 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89869 protein, mRNA (cDNA clone MGC:89869 IMAGE:7029161), complete cds
Gene Symbol: MGC89869
Gene ID: 448676
ORF gb_acc: MG133152
ORF ID: 10595

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077030

Library Location

Plate ID: GDExt11006
Well Location: C06

EST Sequences

Clone: MGC:89869 IMAGE:7029161
Trimmed Sequence: ATGAGTTCACTGTCAACGAGCACCGTACGGGCGATTTTCAAAGCTTTAGGTGATGGCCCCGGATTCGATCGAGTTTTGAGTAAGCTGAACCTGGTGTCTGCTGCTCCAGGGAAAGTTGTCTGCGAACTCCAAGTTGAAGAAGAGCATACAAACAGAGGTGGCACTTTACACGGAGGACTGACTGCTACTCTAGTTGATACGGTTTCCACAGTTGCCCTTCTGCACACAGAAAGAGGTGCTCCTGGAGTTAGCGTTGATATGAATATTACGTACATGAATGCTGCAAAAATTGGGGACTCTGTACTAATCACAGCTCAAGTTTTGAAGCAAGGAAGAACACTAGCATTTGCAACTGTAGATGTGACTAATAAAGTTTCAGGAAAACTAATTGCACAAGGGCGACACACAAAGCACCTTGGCAACTGA
Full Trace Sequence: ccgggaaggctgggacacgaactgcatgcaacactaagcgaggtgtttgttataagtagaggtcacctaaagtgacaattgctgtacaacgtcccagggagacaaggatttgttctcttgtggtccgggtaaatacgtctcccagcgatgagttcactgtcaacgagcaccgtacgggcgattttcaaagctttaggtgatggccccggattcgatcgagttttgagtaagctgaacctggtgtctgctgctccagggaaagttgtctgcgaactccaagttgaagaagagcatacaaacagaggtggcactttacacggaggactgactgctactctagttgatacggtttccacagttgcccttctgcacacagaaagaggtgctcctggagttagcgttgatatgaatattacgtacatgaatgctgcaaaaattggggactctgtactaatcacagctcaagttttgaagcaaggaagaacactagcatttgcaactgtagatgtgactaataaagtttcaggaaaactaattgcacaagggcgacacacaaagcaccttggcaactgatgtagacagcatatttcagaaccaatttatctgcagtagtattggtgaatgtctcaagcaagaacattgtgttactaagctattattctgctgcagtagaaggaaaatatatcaatttaacccccaaaaaaaaaaaaaaaaaaaaaa
Translation: MSSLSTSTVRAIFKALGDGPGFDRVLSKLNLVSAAPGKVVCELQVEEEHTNRGGTLHGGLTATLVDTVSTVALLHTERGAPGVSVDMNITYMNAAKIGDSVLITAQVLKQGRTLAFATVDVTNKVSGKLIAQGRHTKHLGN
Donor tissue: