ORFeome > MGC89913 – XORFeome 2.0

MGC89913 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89913 protein, mRNA (cDNA clone MGC:89913 IMAGE:7029909), complete cds
Gene Symbol: MGC89913
Gene ID: 448727
ORF gb_acc: MG133140
ORF ID: 10581

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077686

Library Location

Plate ID: GDExt11006
Well Location: A05

EST Sequences

Clone: MGC:89913 IMAGE:7029909
Trimmed Sequence: ATGGCCACCAACGATTACTCGCAACAAGCCAGCCAAGGGTATGGGGCATACCCCTCCCAACCAAGCCAGGGTTATGGGCAGCAGGGCAGCCAGTCCTACAGCCAGCAAGGTTACAGTGGTTACGGCCAGTCTGCAGGTGGCTCCTCGTATGGACAGAGTGGCTACAGCTCTTCATGTGGTCAAGACCAGAGTGCTGGATATAGTTCTCAGTCAACTCCACAAGGATATGGATCTGGTGGTTATGGAAACTCCCAATCATCTCAGTCCCCTTATGGCAGCGGGCAGCCACAGCAGCAGTCCCAGTCCTCTTACTCCAGCTACTCCCAGCAGCCTCCAGCCAGTAGCAACACAGGAAGTGGCAGCTCCCAGCCATCCAGCTACCAGCAGCAGCAGAGTGGTGGATATGGGCAGCAACCAAGTGGGGGTTATGGAAGTCAGCAGAGCAGCTATGGAGGTCAACAGCAATCCAGTTATGGGAGCCAGCAGGGTCAGAGTGGCTATGGCAGTCAGCAGCCAAGCTCTTATGGACAGCAGCAGCAATCAAGCTACAGCCAGCCCCAGGGCTATGGCCAGCAGCAAACACAGTATAGTGGTGGAGCTGGTGGATATAATCAGGACTCTCCTTCCATGGGCAGCGGAAGCTATGGTGGAGGGTCTGATCAGGGTGGCTATGGAGGCCAAGATAGAGGAAGGGGACGTGGAGGATTTGGTGGTCGTGGTGGTGGTGGTGGAGGAGGAGCAGGTGGCTTTGACAGCCGCGGAAGGGGCAGCCGTGGTGGCAGAGGCGGCATGGGGTAG
Full Trace Sequence: acagtgcgcagcggaggtgatatatcgtggttactaggcggtacttggagaacatcagtgataccgcaacatggccaccaacgattactcgcaacaagccagccaagggtatggggcatacccctcccaaccaagccagggttatgggcagcagggcagccagtcctacagccagcaaggttacagtggttacggccagtctgcaggtggctcctcgtatggacagagtggctacagctcttcatgtggtcaagaccagagtgctggatatagttctcagtcaactccacaaggatatggatctggtggttatggaaactcccaatcatctcagtccccttatggcagcgggcagccacagcagcagtcccagtcctcttactccagctactcccagcagcctccagccagtagcaacacaggaagtggcagctcccagccatccagctaccagcagcagcagagtggtggatatgggcagcaaccaagtgggggttatggaagtcagcagagcagctatggaggtcaacagcaatccagttatgggagccagcagggtcagagtggctatggcagtcagcagccaagctcttatggacagcagcagcaatcaagctacagccagccccagggctatggccagcagcaaacacagtatagtggtggagctggtggatataatcaggactctccttccatgggcagcggaagctatggtggagggtctgatcagggtggctatggaggccaagatagaggaaggggacgtggaggatttggtggtcgtggtggtggtggtggaggaggagcaggtggctttgacagccgcggaaggggcagccgtggtggcagaggcggcatggggtaggtatttcatcaggcaaagttagaaattacagctgtgagtgtgtgtaatgtgtgagaaagtggtctgtgttggaagcaatttgagtgaattcttgttccttctggattttgatgtgtagcctaaaaaaaaaaaaaaaa
Translation: MATNDYSQQASQGYGAYPSQPSQGYGQQGSQSYSQQGYSGYGQSAGGSSYGQSGYSSSCGQDQSAGYSSQSTPQGYGSGGYGNSQSSQSPYGSGQPQQQSQSSYSSYSQQPPASSNTGSGSSQPSSYQQQQSGGYGQQPSGGYGSQQSSYGGQQQSSYGSQQGQSGYGSQQPSSYGQQQQSSYSQPQGYGQQQTQYSGGAGGYNQDSPSMGSGSYGGGSDQGGYGGQDRGRGRGGFGGRGGGGGGGAGGFDSRGRGSRGGRGGMG
Donor tissue: