ORFeome > MGC90003 – XORFeome 2.0

MGC90003 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC90003 protein, mRNA (cDNA clone MGC:90003 IMAGE:7026408), complete cds
Gene Symbol: MGC90003
Gene ID: 448698
ORF gb_acc: MG133067
ORF ID: 10483

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077057

Library Location

Plate ID: GDExt11005
Well Location: F06

EST Sequences

Clone: MGC:90003 IMAGE:7026408
Trimmed Sequence: ATGGCACCAGCAAAGAAGGGTGGTGAGAAGAAAAAGGGCCGCTCTGCCATCAATGAGGTGGTCACTAGAGAATACACCATCAATATTCACAAAAGGATCCATGGAATTGGGTTCAAAAAGCGTGCACCTAGGGCTCTTAAAGAGATCAGGAAGTTTGCAGTGAAAGAAATGCGTACTCCTGATGTTCGTATTGATACCAGACTGAACAAAGCTGTTTGGGCCAAAGGAATCAGAAATGTTCCATATCGCATACGTGTACGTTTGTCAAGAAAGCGCAATGAGGATGAAGATTCTCCTAACAAACTTTACACACTGGTCACATATGTACCTGTCACAAACTACAAAGGCCTTCAAACCGTCAATGTTGATGAAAACTAA
Full Trace Sequence: gctttccgacatagtccctggttgaaaatggcaccagcaaagaagggtggtgagaagaaaaagggccgctctgccatcaatgaggtggtcactagagaatacaccatcaatattcacaaaaggatccatggaattgggttcaaaaagcgtgcacctagggctcttaaagagatcaggaagtttgcagtgaaagaaatgcgtactcctgatgttcgtattgataccagactgaacaaagctgtttgggccaaaggaatcagaaatgttccatatcgcatacgtgtacgtttgtcaagaaagcgcaatgaggatgaagattctcctaacaaactttacacactggtcacatatgtacctgtcacaaactacaaaggccttcaaaccgtcaatgttgatgaaaactaaatggcgttcattgttaaaataaaaagtaaaactaaaaaaaaaaaaaaaa
Translation: MAPAKKGGEKKKGRSAINEVVTREYTINIHKRIHGIGFKKRAPRALKEIRKFAVKEMRTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTNYKGLQTVNVDEN
Donor tissue: