ORFeome > MGC97537 – XORFeome 2.0

MGC97537 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC97537 protein, mRNA (cDNA clone MGC:97537 IMAGE:5383384), complete cds
Gene Symbol: MGC97537
Gene ID: 595019
ORF gb_acc: MG134455
ORF ID: 12158

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC091584

Library Location

Plate ID: GDExt11020
Well Location: D10

EST Sequences

Clone: MGC:97537 IMAGE:5383384
Trimmed Sequence: ATGGCCAGTGACCCTCCCCCGCCCTACCCCGGGGGCCCATCGGCCCCACTGCTGGAGGAGAAGCAGGGACTGCCCAGAATGGAAGAGCCCAGAGCTGCTCCATACCCACAGGCCATGCCGTTTGCACCCCCAGATTGTGGCCCCCCTCCATATGATGCCAACCCCGGATACATTGCCCCTAATCCAGGTTTTTACCCTCCCCCTGGGCCCTATGCACCAATGGGTTATTACCCGCCAACACCTGGCCAGTTCCAGCCGCCCTACCCATCCCAGTACCCGTCCCCCGGGGCACAGGGCACCGCAGTAATTGTGCCGCCGGGACCCAGTTCTACCTCCGCCGCCACCACCGTGACCTCCACTACTACCACTGTGACTGTGCTGCAGGGAGAGATCTTCCAGGGCTCCCCGGTACAGACCGTGTGTACCAACTGCCAGCAGCCAATCACCACTAAAATCTCCCACGATATCGGCCTCATGAACTTCCTGCTCTGCTGCTTCTGCTGCTTTGTTGGGTGCGACTTGGGTTGTTGCCTGATTCCGTGCATAATTAATGACCTGAAGGATGTAACGCACAGCTGCCCCAACTGCAAGTACCACATCTATACCTACAGGAGGATGTGCTAA
Full Trace Sequence: gcgggatcccgttgtcaaggcaatggccagtgaccctcccccgccctaccccgggggcccatcggccccactgctggaggagaagcagggactgcccagaatggaagagcccagagctgctccatacccacaggccatgccgtttgcacccccagattgtggcccccctccatatgatgccaaccccggatacattgcccctaatccaggtttttaccctccccctgggccctatgcaccaatgggttattacccgccaacacctggccagttccagccgccctacccatcccagtacccgtcccccggggcacagggcaccgcagtaattgtgccgccgggacccagttctacctccgccgccaccaccgtgacctccactactaccactgtgactgtgctgcagggagagatcttccagggctccccggtacagaccgtgtgtaccaactgccagcagccaatcaccactaaaatctcccacgatatcggcctcatgaacttcctgctctgctgcttctgctgctttgttgggtgcgacttgggttgttgcctgattccgtgcataattaatgacctgaaggatgtaacgcacagctgccccaactgcaagtaccacatctatacctacaggaggatgtgctaagggggtcctccatcatttcatctctccgtccatggagatgccagccacccaaccttccacagactggaaatgatcccagcgggttacatgaaggggcatctctttttgaagcacatttcgggccagcgccccctagtgccagtgagtgtagaaccctggcttccctgtatatgggggccttaggctgtgtgtaagttgaacgtgggggggggttgtgctacattctaagttagtgtcctgtccacaagctgccagtgaggcctccgtcaagaaccttcccattgtagggtgtgtccaatcagcacagggaatcggtgccccatatcactagctcaggactttgtgttaaccctttcactgcagcctaggtatataacaccactgtctgcagtcagggggtaaaacgttgcatgcaatcttccagctagtgtcttcatgcacccccccaaccaacattcatgtttccctgcaccccatgtcaccctttcctttgcgttgtgctgtgaccccgtgcctacaagacgttttctgattggcctgttctgctgccttaccccttctcacttgctacagtgtttggaatgttccatttgctgcctctctgaaggggagccaggaatcaactcagcagatagtttactttttacattttgtacaaactatagattgatatataacgagttttgctgctttctatattctcctgagcatgagatacggggctgtacattatctactgataataaagctgcacaggaaggaaatacgttatagggggggttaaagaataacacaggaatggtgagtgcatggcggctctccttgtttattgcccaggggtaaataactgagccccactagtgtgttgcaccaatagtcttaatgctgaggggtgcaagtctactgctgccctaaaccccaggcaatagtgaaagagtggggtgcggggggcccatgtgttgttcttgtgatgagcttgcacgtctgtagggttgccttcccctttatcattgtagcattggtgggaatggcgctcgctctatggttatgaagcaaagcttccgctgaatctttcttacccttttgtgtcactttactgccctgttgctaaaccctatcccaggctctcacctcaggcaaaatattttctactgtgtgaagactctccttttaaaggggaaataccctttttataaagtttggaagaggagttgtgggcagtgtctagaggagatttcccttccctttaactctgtgtgtttgccagttgttcctggctaccagtttggctagcagccgggccatattatacccagtggcacacaggcctcttggcaaggtacatccatgagtggctgccagtatattcctgtgcaatgggcataaccaggacagggatttgggcactgggcagctgctggcatgtacaagggcaagggagcctgaaagtttaagaatccccacgctgatagtaagcccctccccaaacatggctgcttggtgtaaccagagacaaatgaatttccgactgtgtgcgagccgcttgcacttggtttcctcatgtttggctgtaggattctgcctgccgacaactgcagcttcctcatgcctcccctgcatgcactgtgccaccatcattcctcctgggggaggagccaactgagccctcgctgtgttgggcagcggatctttcctgctatcaccagcactgtagccacacaggactgtatgatccgcatgggactgtgcacttactgtcagcttactggtacgtccattaaactgtgatctgagcagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MASDPPPPYPGGPSAPLLEEKQGLPRMEEPRAAPYPQAMPFAPPDCGPPPYDANPGYIAPNPGFYPPPGPYAPMGYYPPTPGQFQPPYPSQYPSPGAQGTAVIVPPGPSSTSAATTVTSTTTTVTVLQGEIFQGSPVQTVCTNCQQPITTKISHDIGLMNFLLCCFCCFVGCDLGCCLIPCIINDLKDVTHSCPNCKYHIYTYRRMC
Donor tissue: neurula