ORFeome > MGC97606 – XORFeome 2.0

MGC97606 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC97606 protein, mRNA (cDNA clone MGC:97606 IMAGE:6978171), complete cds
Gene Symbol: MGC97606
Gene ID: 548528
ORF gb_acc: MG134436
ORF ID: 12136

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC090092

Library Location

Plate ID: GDExt11020
Well Location: A12

EST Sequences

Clone: MGC:97606 IMAGE:6978171
Trimmed Sequence: ATGACTTCCCAGTGCCCCCGCTGCCGGGCCCCCGTCTACTTCGCAGAGAAAGTGAGCTCCTTGGGGAAAAACTGGCATCGCTTCTGCCTGAAATGCGAGCTGTGCAATAAGATCCTGTCTGCGGGCGGCCATGCCGAGCATGACGGACAGCCCTACTGCCACAAGCCCTGCTACGGTGCCCTGTTTGGCCCCAAAGGGGTGAATATCGGCGGTGTCGGATCCTACATCTATGATACGACCCCCCAAATCTCACAGAATCCAGTATCTCCCACCCTGTGTGTCCCAAACCACTCCAGTAGCACCAACACAAAACCAGCAACTAAAGCCCCAGCACCAATGAGAACCTTCGCTGGCGAGACGGCGCTGTGCCCGGGCTGCGGGAAACCAGTGTTCTTCGCTGAGAAAGTGATGTCTCTAGGGAGAAACTGGCACCGCCCGTGCCTGAGATGCCAGCGCTGCAACAAAACATTAACTGCAGGGGGGCACGCAGAGCATGATGGGCTGCCATACTGCCATGTTCCATGCTACGGCTACCTCTTTGGACCAAAAGGAGTGAACATTGGTGACGTTGGCTGTTACCTGTACGATCCATTAACCGAGACTGTCAATTAG
Full Trace Sequence: gaagctcaatccgctagttgttccctctcctccctggaaatgacttcccagtgcccccgctgccgggcccccgtctacttcgcagagaaagtgagctccttggggaaaaactggcatcgcttctgcctgaaatgcgagctgtgcaataagatcctgtctgcgggcggccatgccgagcatgacggacagccctactgccacaagccctgctacggtgccctgtttggccccaaaggggtgaatatcggcggtgtcggatcctacatctatgatacgaccccccaaatctcacagaatccagtatctcccaccctgtgtgtcccaaaccactccagtagcaccaacacaaaaccagcaactaaagccccagcaccaatgagaaccttcgctggcgagacggcgctgtgcccgggctgcgggaaaccagtgttcttcgctgagaaagtgatgtctctagggagaaactggcaccgcccgtgcctgagatgccagcgctgcaacaaaacattaactgcaggggggcacgcagagcatgatgggctgccatactgccatgttccatgctacggctacctctttggaccaaaaggagtgaacattggtgacgttggctgttacctgtacgatccattaaccgagactgtcaattagatgtctcttccatctgtgcttgtgcccccaagtttcgctgcttccggcgcctcactgtatcgcactgggttcctgaagggaaacggcgggttccatctctcccagcggaaccaagcccggaacatttcactttatcccacggtgggctggatcctctggttctggataataaaaggagcccataatatgcctccgattacagggtgtgtgtgtgggacggtgtctcactggggtacagaaccagcgccagaaccttaggggcaccctgccccatgtgtaactctataactgtcagatcctgccttattcactctcattcggcccaatggtttcatccaatcatttgtccccagatcaaccatcagatcataaaggctcccaatgccgacccacagggatgggagctgtagttcagcgctgcctgttccccttgagctattcctacctgccccctgtgtatctgccacagtctggggcccattggccgggcaggtcccatacacttcccaacaagcggccaaattggtctcaaactatattggcccacatgtgcccaagcgggacgtttcctgcccagctatgaactctatacagtaccgggcgcctgcgaaactgccccaatcaaccttatttatttacattgtatttagagcttccggagcaaagaccggaactttatgtttaatgcacgcgaagcccctgcgatcatttaatattacttgccctttaaagggatactgtctctttaattattcaatgttacttgccctttaaagggatactgtctctttaattattcaatgttacttgccctttaaagggatactgtctctttaatgattcaatgttacttgccctttaaagggatactgtttctttaatgattcgatgttacttgccctttaaagggatactgtctcttaaatgattcgatgttacgtgccctttaaagggatactgtttctttaatgattcaatgttacttgccctttaaagggatactgtttctttaatgattcgatgttacgtgccctttaaagggatactgtttctttaatgattcgatgttacttgccctttaaagggatactgtctctttaatgattcgatgttacttgccctttaaagggatactgtctctttaatgattcgatgttacttgccctttaaagggatactgtctctttaatgattcaatgttacttgccctttaaagggatactgtaaaacaaaataaaaaatatttactttttcctgggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTSQCPRCRAPVYFAEKVSSLGKNWHRFCLKCELCNKILSAGGHAEHDGQPYCHKPCYGALFGPKGVNIGGVGSYIYDTTPQISQNPVSPTLCVPNHSSSTNTKPATKAPAPMRTFAGETALCPGCGKPVFFAEKVMSLGRNWHRPCLRCQRCNKTLTAGGHAEHDGLPYCHVPCYGYLFGPKGVNIGDVGCYLYDPLTETVN
Donor tissue: tailbud