ORFeome > MGC97634 – XORFeome 2.0

MGC97634 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC97634 protein, mRNA (cDNA clone MGC:97634 IMAGE:6979703), complete cds
Gene Symbol: MGC97634
Gene ID: 595066
ORF gb_acc: MG134440
ORF ID: 12141

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC093459

Library Location

Plate ID: GDExt11021
Well Location: A05

EST Sequences

Clone: MGC:97634 IMAGE:6979703
Trimmed Sequence: ATGAGCCGCAGTTACAATGACGAGTTACAGTATCTGGACAAGATCCATAAGAACTGCTGGCGGATCCGCAAGGGCTTCGTGCCCAACATGCAGGTAGAAGGGGTGTTCTATGTGAATGACCCCCTGGAGAAGCTGATGTTCGAGGAGCTGAGGAATGCCAGCCGGGGGGGAGCCGCCGGAGGTTTCCTTCCCGCCATGAAGCAGATCGGCAATGTGGCGGCTTTACCTGGGATCATTCATAGATCTATCGGGCTACCAGATGTGCACTCTGGCTATGGATTTGCCATCGGAAACATGGCAGCGTTTGATATGGACAACCCCGAAGCAGTTGTCTCCCCAGGTGGTGTTGGCTTTGACATAAACTGCGGGGTCCGCCTGCTTCGTACAAACCTCGATGAGAGCGACGTGCAGCCGGTGAAAGAGCAGCTGGCCCAGGCCATGTTCGACCATATCCCAGTAGGGGTCGGATCCAAAGGGGTCATCCCTATGGGGGCCAAGGATCTGGAGGAAGCCCTCGAGATGGGGGTGGACTGGTCGCTGCGAGAAGGCTACGCCTGGGCCGAGGACAAGGAGCACTGCGAGGAGTATGGCCGCATGTTGCAGGCTGACCCCAGCAAGGTCTCCTCTAAAGCGAAGAAGCGAGGGCTGCCTCAGCTGGGGACCCTCGGAGCTGGAAACCATTACGCCGAAGTCCAGGTGGTCGACGACATATACGACGAGTATGCCGCCAAGAAAATGGGCATCGACCACAAGGGGCAAGTGTGCGTCATGATCCACAGCGGCAGCCGCGGCTTGGGGCATCAAGTGGCGACAGATGCTCTGGTTGCCATGGAGAAAGCCATGAAGAGGGACAAGATCACGGTGAACGATCGCCAGTTGGCCTGTGCCCGCATCTCCTCGGCCGAGGGGCAAGATTATCTCAAAGGCATGGCCGCCGCGGGCAACTACGCTTGGGTCAACCGCTCCTCCATGACCTTCCTGACCAGACAGGCCTTCTCCAAAGTGTTCAACACGACTCCGGACGACCTGGACTTGCACGTCATCTACGACGTGTCCCACAACATCGCCAAGGTGGAGCAGCACGTGGTGGACGGGAAGGAGAAGACACTGTTGGTGCACAGGAAGGGGTCCACGCGTGCTTTCCCTCCCCACCACCCCCTCATTCCTGTGGATTATCAGTTGACTGGGCAGCCGGTATTGATTGGTGGAACCATGGGAACCTGCAGTTATGTCCTTACTGGCACTGACCAGGGCATGACTGAGACATTTGGCACTACCTGCCATGGCGCTGGTCGTGCCCTTTCCAGAGCCAAGTCAAGAAGAAACCTTGATTTCCAAGATGTTCTAGACAAACTGGCAGACTTGGGCATCGCCATTCGCGTGGCTTCTCCAAAACTGGTCATGGAAGAGGCCCCCGAGTCGTACAAGAACGTCACGGACGTAGTAAATACCTGCCACGATGCCGGCATCAGCAAGAAAGCCATCAAGCTCCGCCCCATTGCGGTCATCAAAGGCTGA
Full Trace Sequence: gtccccggtgcgtgtgtgtgagggagagaagcgccggcaccatgagccgcagttacaatgacgagttacagtatctggacaagatccataagaactgctggcggatccgcaagggcttcgtgcccaacatgcaggtagaaggggtgttctatgtgaatgaccccctggagaagctgatgttcgaggagctgaggaatgccagccgggggggagccgccggaggtttccttcccgccatgaagcagatcggcaatgtggcggctttacctgggatcattcatagatctatcgggctaccagatgtgcactctggctatggatttgccatcggaaacatggcagcgtttgatatggacaaccccgaagcagttgtctccccaggtggtgttggctttgacataaactgcggggtccgcctgcttcgtacaaacctcgatgagagcgacgtgcagccggtgaaagagcagctggcccaggccatgttcgaccatatcccagtaggggtcggatccaaaggggtcatccctatgggggccaaggatctggaggaagccctcgagatgggggtggactggtcgctgcgagaaggctacgcctgggccgaggacaaggagcactgcgaggagtatggccgcatgttgcaggctgaccccagcaaggtctcctctaaagcgaagaagcgagggctgcctcagctggggaccctcggagctggaaaccattacgccgaagtccaggtggtcgacgacatatacgacgagtatgccgccaagaaaatgggcatcgaccacaaggggcaagtgtgcgtcatgatccacagcggcagccgcggcttggggcatcaagtggcgacagatgctctggttgccatggagaaagccatgaagagggacaagatcacggtgaacgatcgccagttggcctgtgcccgcatctcctcggccgaggggcaagattatctcaaaggcatggccgccgcgggcaactacgcttgggtcaaccgctcctccatgaccttcctgaccagacaggccttctccaaagtgttcaacacgactccggacgacctggacttgcacgtcatctacgacgtgtcccacaacatcgccaaggtggagcagcacgtggtggacgggaaggagaagacactgttggtgcacaggaaggggtccacgcgtgctttccctccccaccaccccctcattcctgtggattatcagttgactgggcagccggtattgattggtggaaccatgggaacctgcagttatgtccttactggcactgaccagggcatgactgagacatttggcactacctgccatggcgctggtcgtgccctttccagagccaagtcaagaagaaaccttgatttccaagatgttctagacaaactggcagacttgggcatcgccattcgcgtggcttctccaaaactggtcatggaagaggcccccgagtcgtacaagaacgtcacggacgtagtaaatacctgccacgatgccggcatcagcaagaaagccatcaagctccgccccattgcggtcatcaaaggctgagcccccgggaaatcggtgactgataaaacgccaatatttgcgctcttcatacctgtcggtctggcagatgttgctgagctcacagcactacagcacgcgaggggttaatcctctgcacttacctggcaacagcaaagccccccaaacctttttttttttttcccccctcctgctgaatttagtagctgagaattatcagcattttttgctttctcttttactaacactgggcaacgtttcccccatgcagtaacccatagcaaccagctgcaagtttacagtagaccgatcaaagctgactgctgattggttgctatgggttactgttttgtgacattggaccagtgttggaataggggctgctgggtattatactgataccgtagagttactactggggcaggttttgctttgtgtgtcttaaatctgcttttttttttgttattggtcagaactggatctcccttcacagagggaagggaatctaatgagggcacttactgtaatagtagagtccaggggtaagtgggcctgctggagagggcatgtatggttggatatttgcccctcagggatgctgggagttcagttcagctgttggtgggagttgtagtttaacaatccccatagggctatgtctgaactagggaacaggcaatcgcctgataacattgtgctgggagttgtagtgcaacaacagctggagggtcaggggttaaactctgaccttttatattacctccccttcagtggggtggggggggggggggtgagcagctttcctgctttgcaaatggggccccccgctatcaccatttgccgactctgcacaagagagaaataaaaaaatccttacaagcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSRSYNDELQYLDKIHKNCWRIRKGFVPNMQVEGVFYVNDPLEKLMFEELRNASRGGAAGGFLPAMKQIGNVAALPGIIHRSIGLPDVHSGYGFAIGNMAAFDMDNPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMGAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPSKVSSKAKKRGLPQLGTLGAGNHYAEVQVVDDIYDEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKITVNDRQLACARISSAEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFSKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKEKTLLVHRKGSTRAFPPHHPLIPVDYQLTGQPVLIGGTMGTCSYVLTGTDQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADLGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG
Donor tissue: tailbud