ORFeome > MGC97646 – XORFeome 2.0

MGC97646 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC97646 protein, mRNA (cDNA clone MGC:97646 IMAGE:6980378), complete cds
Gene Symbol: MGC97646
Gene ID: 595025
ORF gb_acc: MG134418
ORF ID: 12111

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC091601

Library Location

Plate ID: GDExt11020
Well Location: H10

EST Sequences

Clone: MGC:97646 IMAGE:6980378
Trimmed Sequence: ATGGCGGAGCCGACGGACTGCTTCTTACGGGAGCTGGAACTCAGCGATGGCTCTGTTGTGGCTATCCGCCAGCTAAGCTCAGGAGATGTTGGTTGCGTGGTGTGGGACGCAGCTATCGTACTATCAAAGTTTCTAGAGAGTCAGGAATTTAAGTTGCCTGGGGGTCAGCGACTGAGCGGAAAGTGTGTGCTGGAGCTGGGCGCCGGGACCGGCATTGTTGGCATCGTGGCAGCCACTCAGGGAGCAAATGTCATCGTCACTGATCTTGAAGATCTGCAGGAACTAATGAAAATAAACATTGAAAGTAACTCCCACCTTATCACAGGTTCTTGCCAAGCGAAGGTACTAAAATGGGGTGAAGAAGTTAAAGATTTGGTGCCTAAACCCGACTACATCTTATTGGCTGACTGCATCTACTACGAAGAGTCCCTGGAACCATTGCTGAAGACTCTGAAGGACCTTACTGGCATTGACACATGCATCTTGTGTTGTTATGAGCAAAGAACTATGGGCAAAAATCCTCAAATAGAAAGAAGGTTTTTTGAGCTATTAAAAGAAGACTTTAAGTATGAAAAAGTGCCCCTGGAAAAACATGACAAAGAATATCGGAGTGAAGACATTCATATTTTAGAAATTTACAGAAAAACATAA
Full Trace Sequence: cgcggcgtgactgtcatggcggagccgacggactgcttcttacgggagctggaactcagcgatggctctgttgtggctatccgccagctaagctcaggagatgttggttgcgtggtgtgggacgcagctatcgtactatcaaagtttctagagagtcaggaatttaagttgcctgggggtcagcgactgagcggaaagtgtgtgctggagctgggcgccgggaccggcattgttggcatcgtggcagccactcagggagcaaatgtcatcgtcactgatcttgaagatctgcaggaactaatgaaaataaacattgaaagtaactcccaccttatcacaggttcttgccaagcgaaggtactaaaatggggtgaagaagttaaagatttggtgcctaaacccgactacatcttattggctgactgcatctactacgaagagtccctggaaccattgctgaagactctgaaggaccttactggcattgacacatgcatcttgtgttgttatgagcaaagaactatgggcaaaaatcctcaaatagaaagaaggttttttgagctattaaaagaagactttaagtatgaaaaagtgcccctggaaaaacatgacaaagaatatcggagtgaagacattcatattttagaaatttacagaaaaacataagagtttcacatttaatatagatgtccctgtctgttttttagtggcatgttcacatttttctgaccaattctttacgaatcagatttatttatactttgtgtatatcattaaaaatgttcattgatagttccatacatgtgatctgtacatatttgtattgcatctcttggctctgtgcagttgccgatctccaactcatgtgttttacctacaaaggttagtggctggtagtgaatgttacaagataaagtttagcaaatgcaggagaaatgtactgattttatcttcctgtcaagttataggcagttattccatatttagaaaggttacctgcaagagatgaagcttatattaaatatttttttaaaataaaagggtgcactctatttattgataaaataatcttaggttttatgataagtgggttattttattggctgctaagtgtagcagcaaatgtctacaatatactgtagattacttcacattaacagctgttagctggaataggattggttggctaggcagttgtagttctgctgcagctggaatgaaggtgtcctgctataaacagaactacattttgcaaaaagtttttaggaactgtatgcatatgattaagtatggtaaagttgccctgtacattctattgcaacaatgattttgcgagaaactgcagcatatgggatacttaaaataaagtcttcattcggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAEPTDCFLRELELSDGSVVAIRQLSSGDVGCVVWDAAIVLSKFLESQEFKLPGGQRLSGKCVLELGAGTGIVGIVAATQGANVIVTDLEDLQELMKINIESNSHLITGSCQAKVLKWGEEVKDLVPKPDYILLADCIYYEESLEPLLKTLKDLTGIDTCILCCYEQRTMGKNPQIERRFFELLKEDFKYEKVPLEKHDKEYRSEDIHILEIYRKT
Donor tissue: tailbud