ORFeome > MGC97719 – XORFeome 2.0

MGC97719 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC97719 protein, mRNA (cDNA clone MGC:97719 IMAGE:6986422), complete cds
Gene Symbol: MGC97719
Gene ID: 548544
ORF gb_acc: MG134553
ORF ID: 12268

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC090110

Library Location

Plate ID: GDExt11021
Well Location: H11

EST Sequences

Clone: MGC:97719 IMAGE:6986422
Trimmed Sequence: ATGGCTGCTCAAGGTATGTCTCTGCAGGACAAGGTTGCTAAGTTGTTGAGTCGCCGCAATGGGAAGCCTGTGCTTAAACCCAGCCGAGCCCTGGCATTAGCCGACGCAGTGGCCAACCGAAAGCGGAGACTTGGCGAGGCAACTTGTATAACAGAAATGTCTGTAATGATGGCGTGCTGGAAACAGAATGCATTTAGTGACACAGCTTGTAATAAAGAGATAAAGACTTTCTACGACTGTGTTTCAAAAGAACAGGCTGCAAGAAAAGCTGGATTGAACCAGGAAGTCCAAGCAGGACGGTTGCCTCCAAAACAAGTAAACACATTACTGAGACGTTTCCCAAATATTGATCATGAAATATAA
Full Trace Sequence: tccgtccttgcctgtgatggctgctcaaggtatgtctctgcaggacaaggttgctaagttgttgagtcgccgcaatgggaagcctgtgcttaaacccagccgagccctggcattagccgacgcagtggccaaccgaaagcggagacttggcgaggcaacttgtataacagaaatgtctgtaatgatggcgtgctggaaacagaatgcatttagtgacacagcttgtaataaagagataaagactttctacgactgtgtttcaaaagaacaggctgcaagaaaagctggattgaaccaggaagtccaagcaggacggttgcctccaaaacaagtaaacacattactgagacgtttcccaaatattgatcatgaaatataaacatttgaatggtattaacagactattctacatagtgtctttaaaaaatacagtcattatctgctgattttttcttggtaagaaaatgttattccttggagtgatgaagcaagaagaaagttctttcttatttcatggagtaatagttactggacggcgcttctgtttttgaacacaggctgcaaatcaaatatctggaaactgttgcaaatatgaaaggcatatatgcagtcttgcttagatctgcaatcgacatcatgaaaaaaagaaaatacttctacactttacatgattctcatttcttagccatgaaaatatatacattgtaattaaaaaacttcatattctaattgtattaatactgtaaatataataaagagtccaaattagccacaatttggattttttttttttctttttgaacacgtgaatattttttcgggtaatgttcaagctgtttattgtctctttgtgtcccaagccacaaaaatctatccgtaacagtaaataaaataaaaaaaagtatcacagtatttattatttggttaagagaattaaaatataaatatatacaaaagttttgtttttttaaacataattgtaggacagtcgtggctctgtgactgcatgcattgattctgcattctagaaaaccgctcctgtaaattatggggctgatctgtgatagcgctttcgggggggctaactgagtttttttttccctccaaatcccacatgacttccccataagattaccagtagagtgtctgatatgaaatgctttcacacacaagaatacaatgttacatttttatttgtttactgctattgtgtatagtgtgattgcaaatcattttccactgagttttgtatatcgtgattcggattgcgtaatcatttctattaaaaagcagtagatttgtcatatgtgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAAQGMSLQDKVAKLLSRRNGKPVLKPSRALALADAVANRKRRLGEATCITEMSVMMACWKQNAFSDTACNKEIKTFYDCVSKEQAARKAGLNQEVQAGRLPPKQVNTLLRRFPNIDHEI
Donor tissue: gastrula