ORFeome > MGC97722 – XORFeome 2.0

MGC97722 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC97722 protein, mRNA (cDNA clone MGC:97722 IMAGE:6986559), complete cds
Gene Symbol: MGC97722
Gene ID: 548546
ORF gb_acc:
ORF ID: 12211

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC090113

Library Location

Plate ID: GDExt11022
Well Location: C02

EST Sequences

Clone: MGC:97722 IMAGE:6986559
Trimmed Sequence: ATGAGAGACGCAACTGTGGTGGGCAAGTCATTGGTCCTTAAAAGATCCACTTTCCGTCGACATCCAAAGGCTGTTGAGTCCTTGACCAAGCTGTGTGTACGGCATGGAACGATACCTAAGAGACAAATATGTAAATTTGAAGAAGGTCAAGATGTCCTAGCAAGATGGTCAGATGGATTGTTTTATCTTGGAACTATCAAAAAGATAAATAAGTTGAGACAGAGCTGCTTTATCTTATTTGAAGATAGCTCAAAATCGTGGGTACTCTGGAAAGATATACAGACAGGAGCCTTTGAAAGTGAGGAAATGGTTTGTTCAATATGCCAAGAAGAATATTCTGATGCACCAAATGAAATAGTTATATGTGACAAATGTGGCCAAGGTTATCATCAGTTGTGTCACACTCCAAAAATTGACCCCAACGTGATAGAAACAGATGAAAAATGGCTTTGCCGGCAATGTGTTTTTGCATCTACAACAAAGAGAGGAGGCGCACCGAAGAAAGGGCCCAATGCAAAAGCTTTGCAAGTCATGAAGCAGAGTTTACCATACAACTTGGAAGACTTGGAATGGGATATAGGCCATAAAACCAATGTACAGCAATGTTACTGCTACTGTGGAGGTCCAGGAGACTGGTATTTAAAGATGCTTCAGTGCTGCAAATGTAAGCAATGGTTCCACGAGGCCTGCGTGCAATGCTTGGAAAAACCTATGCTCTTTGGGGACAGATTTTATACGTTTATTTGTTCAGTCTGCAATTCTGGACCAGAATACCTCAAACGTCTATCTTTGAGATGGGTAGACATAGCACACCTATGCTTATACAATCTAAGTGTTATTCACAAGAAGAAGTACTTTGATTCAGAACTTGAACTTATCACATACATAAATGATAACTGGGATCGAATACAACCTGGAGAGCTGGCTGACACACCAAGATCAGAAAGATATGAACATATTCTGGATGCATTAAATGAAAATAAAACAATGTTTATGTCTGGAAAAGAAATTAAGAAAAAGAAACATTTGTTTGGCTTGAGAATTAGAGTTCCTCCAGTGCCTCCTAATGCAGCAGTTAAAATGGAAAAAGAGGAAAGTACATCTCATGAGTTCAAGATTAAGGGCAGAAAGTCTTCAAAGGTTACACCTGTCACAAAAGAGATAAACAATGGTGAGGTGAAAAAGAGGAAACCAGTTGGAAGACCACCAGGTTCTCACAGGAGAAAAATTTTGCAAAATGAGCCATGTGAAACCCCATCTCTGGCAAATAACATGGATACTGAACCTGTATCAGAGAATTCCTTGTTAGATACACCAGAACAAAGAAGCAGGAAACCGGAGGTGACCAATTCATCATCCAGTAACTCAGATTTAGAAACCAGTGGTGCTGTCAGTGCAAAAGAAACTACCTCATCTATTGTTTCCAGTCCTCAGCCTGACTTCAGGAGGGTGACCCGCACAGGCCGGACCTGGCCTGCTTCAATACCACCACAGAAAAAGAGGGGACGCCTTCCACGGAGAGCTCTGCAGACTCACAATTCAGACCTTACAAAGAATGATGAAAGCAAAGAAGATTTGCAGCCTGCTGGACTCAATACAGATATTGTTAAAAACTTGACTGAGCAGGACTTACAGTTGAATCATTTGAAGAATTCCATTACTAATTATTTTGGTGCTGCGGGCAGGATAGCATGTGGTGAAAAGTATCGTATTTTGGCACGCCGAGTAACGCTTGATGGAAAGGTGCAGTATCTTGTAGAGTGGGATGGGGCAACTGCCTCCTGA
Full Trace Sequence: ccaaaatggcgaagggctgcaagcgaaccgggctgcctctgtgccgctggtaaccgaagatcggaaagttaggaacccgttgtgccgccagctgaagggcaaccaccagacggctaatacgtttatagggctctcttctgttttagcggtagtgagcgcgccgcactaccgaagagaccgaatgagagacgcaactgtggtgggcaagtcattggtccttaaaagatccactttccgtcgacatccaaaggctgttgagtccttgaccaagctgtgtgtacggcatggaacgatacctaagagacaaatatgtaaatttgaagaaggtcaagatgtcctagcaagatggtcagatggattgttttatcttggaactatcaaaaagataaataagttgagacagagctgctttatcttatttgaagatagctcaaaatcgtgggtactctggaaagatatacagacaggagcctttgaaagtgaggaaatggtttgttcaatatgccaagaagaatattctgatgcaccaaatgaaatagttatatgtgacaaatgtggccaaggttatcatcagttgtgtcacactccaaaaattgaccccaacgtgatagaaacagatgaaaaatggctttgccggcaatgtgtttttgcatctacaacaaagagaggaggcgcaccgaagaaagggcccaatgcaaaagctttgcaagtcatgaagcagagtttaccatacaacttggaagacttggaatgggatataggccataaaaccaatgtacagcaatgttactgctactgtggaggtccaggagactggtatttaaagatgcttcagtgctgcaaatgtaagcaatggttccacgaggcctgcgtgcaatgcttggaaaaacctatgctctttggggacagattttatacgtttatttgttcagtctgcaattctggaccagaatacctcaaacgtctatctttgagatgggtagacatagcacacctatgcttatacaatctaagtgttattcacaagaagaagtactttgattcagaacttgaacttatcacatacataaatgataactgggatcgaatacaacctggagagctggctgacacaccaagatcagaaagatatgaacatattctggatgcattaaatgaaaataaaacaatgtttatgtctggaaaagaaattaagaaaaagaaacatttgtttggcttgagaattagagttcctccagtgcctcctaatgcagcagttaaaatggaaaaagaggaaagtacatctcatgagttcaagattaagggcagaaagtcttcaaaggttacacctgtcacaaaagagataaacaatggtgaggtgaaaaagaggaaaccagttggaagaccaccaggttctcacaggagaaaaattttgcaaaatgagccatgtgaaaccccatctctggcaaataacatggatactgaacctgtatcagagaattccttgttagatacaccagaacaaagaagcaggaaaccggaggtgaccaattcatcatccagtaactcagatttagaaaccagtggtgctgtcagtgcaaaagaaactacctcatctattgtttccagtcctcagcctgacttcaggagggtgacccgcacaggccggacctggcctgcttcaataccaccacagaaaaagaggggacgccttccacggagagctctgcagactcacaattcagaccttacaaagaatgatgaaagcaaagaagatttgcagcctgctggactcaatacagatattgttaaaaacttgactgagcaggacttacagttgaatcatttgaagaattccattactaattattttggtgctgcgggcaggatagcatgtggtgaaaagtatcgtattttggcacgccgagtaacgcttgatggaaaggtgcagtatcttgtagagtgggatggggcaactgcctcctgaattcgttccaactgtgcgatatgaagaggatatatagcttcttgtactgtaagaccatttatttaaaaaggtgcctgcaagccctgtggtacaaaaggtctctcaacatgctcactgctgaccctgtaatacaaaatgcccactggggtggcaattttactgcatttgtttcacaatttgtgccactgtttaccagagggaacactgcttttaaccaaatatctgcaacagtgcacatttctgagaatctggtttacagtatttctaatcaaacctgttaatgtattgtgtatgtaatgtggctttcatgtttagcaagtattgccctctcttctaccgaagaggcttgcatcttattcttatgcaggcctgtctggcagacaaagaatttcctgttttaaagtgtttaaaagccgaagtgccaccatagctgcaactctcacccatccaaccagtactttttctacactgcagtcatttttaaaacaacctcaaaaatggaatttagaatggcattgtagagcaggccagctccagggctaaaaactgaatgaacccaaaaccaaaagagtttaacttaaaaaaataaattagctttacccgaagcaatggttgagttatacagaaaatgggatataaacacatttacctcttccatttagtagaatccaaagaaaatttttgttatgaactacagagttgcgctgtaacggctgttacctagggggttatattaattttcgttaaggaacacagaaattggcacacactctgtacatggcttggctctgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MRDATVVGKSLVLKRSTFRRHPKAVESLTKLCVRHGTIPKRQICKFEEGQDVLARWSDGLFYLGTIKKINKLRQSCFILFEDSSKSWVLWKDIQTGAFESEEMVCSICQEEYSDAPNEIVICDKCGQGYHQLCHTPKIDPNVIETDEKWLCRQCVFASTTKRGGAPKKGPNAKALQVMKQSLPYNLEDLEWDIGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLEKPMLFGDRFYTFICSVCNSGPEYLKRLSLRWVDIAHLCLYNLSVIHKKKYFDSELELITYINDNWDRIQPGELADTPRSERYEHILDALNENKTMFMSGKEIKKKKHLFGLRIRVPPVPPNAAVKMEKEESTSHEFKIKGRKSSKVTPVTKEINNGEVKKRKPVGRPPGSHRRKILQNEPCETPSLANNMDTEPVSENSLLDTPEQRSRKPEVTNSSSSNSDLETSGAVSAKETTSSIVSSPQPDFRRVTRTGRTWPASIPPQKKRGRLPRRALQTHNSDLTKNDESKEDLQPAGLNTDIVKNLTEQDLQLNHLKNSITNYFGAAGRIACGEKYRILARRVTLDGKVQYLVEWDGATAS
Donor tissue: gastrula