ORFeome > MGC97814 – XORFeome 2.0

MGC97814 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC97814 protein, mRNA (cDNA clone MGC:97814 IMAGE:6991540), complete cds
Gene Symbol: MGC97814
Gene ID: 548556
ORF gb_acc: MG134478
ORF ID: 12184

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC090128

Library Location

Plate ID: GDExt11021
Well Location: A11

EST Sequences

Clone: MGC:97814 IMAGE:6991540
Trimmed Sequence: ATGGGCTGTCAGGAAGTCCACGCAGTGACCTTATTCGCCTTCGTATGCGGGACAGCCTCCATCTCGGGGCTCTTTGCTGCCACTCTGCTGCCTCAGTGGAGGCAAATGAAACTTTACACGTACAACCGGAATGAGAAAAACCTGACTGTTAGCATTGGGCTGTGGGTGAAATGCACACGCTTGGAGTGGAGCAGGGAGTGCATGATGTATGACATGGAGTGGTACGCAAGCGTGGATCAGCTGGACATCCGTGTTCTGCAATTCGCTCTGCCCTTTAGCATCCTGACCGCTGCCTCGGCACTCATATTGTGTCTGACTGGAATCTGTAACACTACCTTTACCTCCGGTGTGCCAAACCTAAAGCTTGTCAAATGCCTCGTTAACAGTTCTGGGTGCCATCTTGTGGCAGGGCTGTTATATATACTAGCAGGTATCATGAGCATTATGCCATCCATCTGGTCTGTGTTTTACAACAGCGTTCTAAACACCAAGTACGGGCCCTACTTTACTTACGACATTGCAGTTTTTGTGGCTATTGGCAGTTCTGGGGGCATGTTCTTTACTGCTGTCCTGCTGTTTCTGTGGTATTGTGCCTGCAAATCTCTGCCCTCTCCATTCTGGCAGCCCTTGTATTCCCACGTCCCTAGTATGCACAGCTACGTGCCCCCGTCCTACCAGTCTCGCTCCCGCATGTCAGCCATTGAGATAGACATTCCCGTTGTTACACACACTGCCTAA
Full Trace Sequence: gtcagagtgctgtgtgggagaccgagcgcttagctcgctgcttgttccttgctggctgccagaactttcaagagagaccataatgggctgtcaggaagtccacgcagtgaccttattcgccttcgtatgcgggacagcctccatctcggggctctttgctgccactctgctgcctcagtggaggcaaatgaaactttacacgtacaaccggaatgagaaaaacctgactgttagcattgggctgtgggtgaaatgcacacgcttggagtggagcagggagtgcatgatgtatgacatggagtggtacgcaagcgtggatcagctggacatccgtgttctgcaattcgctctgccctttagcatcctgaccgctgcctcggcactcatattgtgtctgactggaatctgtaacactacctttacctccggtgtgccaaacctaaagcttgtcaaatgcctcgttaacagttctgggtgccatcttgtggcagggctgttatatatactagcaggtatcatgagcattatgccatccatctggtctgtgttttacaacagcgttctaaacaccaagtacgggccctactttacttacgacattgcagtttttgtggctattggcagttctgggggcatgttctttactgctgtcctgctgtttctgtggtattgtgcctgcaaatctctgccctctccattctggcagcccttgtattcccacgtccctagtatgcacagctacgtgcccccgtcctaccagtctcgctcccgcatgtcagccattgagatagacattcccgttgttacacacactgcctaacgttagcatggtatgcctgtgcttatggactttcatggtacacctcacttttgtgtatatatatattattttttttgtacatattaggattccttcaatttgtttccacttctctttttttcttgtgtaacctgctaaggtagtacttacagtatcccaacagtgctatgatttgttgatccaacttggacacagatctaagaacaatgacctccctgtaaataatgccttaggattacttaacctaaaatactagctgccctgatataaaaataaatagaaatataaaaaaaaaaaaaaatttagtgggtaatataacaggagcagtggttgctccaggtctagtaaaccactagaccagatgtttgctttctctgattggctgcatttctagaactggtgcagacttatttatacattaccccaatactgtttatcatgggagggtagaacacacaatactttttagcctttacaagcagactgtattcatatgggatttctcaaaactgatccaagggcttactctgagcgataattataaaatatggttataaatgataatattgccaaccattactgtgtgtgtgggcagctatagccacaggacgtttggtaggaatgggaaaatggtctcaagaatgactgtgccatctactcttgcatgctgggattatataatccgggtttagggcctgttggattggcctctgctttttaatgctaagtgattttagtgccaattcccgattggcaaaggtacaataacactgaattattttttcttttgatgaactgaagcaaaatagtaattgacctgtatctgtaacactataatacagcaacacgttacttttagtagtgtaagtttgtaataagagtcagtatgtatatttattgttaattggaaagcttaatttttatgcatttgtatttaaagttgtttcagctacaaatatgaaactagcacccctcgttctccctaggttgtagcatccagaactagccattgattgagagaggatgctgggaattatagtttatccgtgctggaagactaccatctattctttatctagtagggattattgtatattttatgctgtgacaagtgtttacagaagtagactaaatcactggtgttctgtttagtactggtttctcaagtgcattcctataaaatgtctcttttctattttgtttgttctgttccagtacagtatattgagcaaaactgctgctaaatgaattgtgtaatgcactgtagataatcttacgtatctgcctttaaattgtgtgcttgtatcatgcattaaaggcaaactcatttttgggggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGCQEVHAVTLFAFVCGTASISGLFAATLLPQWRQMKLYTYNRNEKNLTVSIGLWVKCTRLEWSRECMMYDMEWYASVDQLDIRVLQFALPFSILTAASALILCLTGICNTTFTSGVPNLKLVKCLVNSSGCHLVAGLLYILAGIMSIMPSIWSVFYNSVLNTKYGPYFTYDIAVFVAIGSSGGMFFTAVLLFLWYCACKSLPSPFWQPLYSHVPSMHSYVPPSYQSRSRMSAIEIDIPVVTHTA
Donor tissue: neurula