ORFeome > mid1ip1 – XORFeome 2.0

mid1ip1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MID1 interacting protein 1 (gastrulation specific G12-like (zebrafish)), mRNA (cDNA clone MGC:75801 IMAGE:5382246), complete cds
Gene Symbol: mid1ip1
Gene ID: 394600
ORF gb_acc: MG132956
ORF ID: 10332

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061317

Library Location

Plate ID: GDExt11004
Well Location: H04

EST Sequences

Clone: MGC:75801 IMAGE:5382246
Trimmed Sequence: ATGATGCAGATATCAGACACCTACAACCAGAAGCATTCCCTGTTCAATGCCATGAACAGATTCATTGGAGCTGTGAATAATATGGATCAGACTGTGATGGTTCCCAGCTTGCTTAGGGATGTGCCTCTTGATATGGAAGTAAAGGATGAGGTTCACAACACCAATGGAGCCACAAATTATTTCTCCCGGAGGGACATGCACGGCTATTATATCCTGCTCAAATCCATTAGGAATGATATAGAGTGGGGTGTCGTACAGGGAGAGGACAGGAAAAAGGACAAACTCTCCAACATGGAAATCAGCAGGCTGGAGGATGGAGACGGGGAGGAGGACTTGGAAAAGCAATTCCACTATCACCTGAGTGGACTCCACACAGTCCTTAACAAACTCACCAGAAAAGCCCATCTTCTCACCAACAGATATAAAGAAGAAATTGGGTTTGGCAGTTGGGGACATTGA
Full Trace Sequence: gtggatgtgaaagttgtatctcccttgctgcagggaagtggatgctgggacagcagtgatgagagaagagctgaatcatcttcaactataaaaggaattagagagtggtttcctgtaagctcttggaacacagtattgcactagggtttgcagaagtgggcgatttgtaccattaaaggaaatttaccgctagtgtgcaatcatgatgcagatatcagacacctacaaccagaagcattccctgttcaatgccatgaacagattcattggagctgtgaataatatggatcagactgtgatggttcccagcttgcttagggatgtgcctcttgatatggaagtaaaggatgaggttcacaacaccaatggagccacaaattatttctcccggagggacatgcacggctattatatcctgctcaaatccattaggaatgatatagagtggggtgtcgtacagggagaggacaggaaaaaggacaaactctccaacatggaaatcagcaggctggaggatggagacggggaggaggacttggaaaagcaattccactatcacctgagtggactccacacagtccttaacaaactcaccagaaaagcccatcttctcaccaacagatataaagaagaaattgggtttggcagttggggacattgatgaccgtggcctttagtttttgtacctgttttattaatattatttttttattgtattttgttggggatatgggatagttttctttttcatttttgtatgccattttgtgctgcagaccagtgcaaaatggctcaggaggatttagttggagatgtagattatgttttatcacagagtactgcatttataggacagtactgtctcagttcactgttataattcatttaattgatagttcagcagctgcttaaagtgagcaatctgcaaaagaatgaataatggtttgaaagaggatacatttgacattttgtatagcatttttcatttactttgcaaaagcacagagtatcctaaaatattagaagaaacaacattatcttctgtaacataaggctatgattatgctgtgttataccagacaactccctgtctagcaccgttgctgcaaaaccataaaaatgaagaatagcttgaacagcagtgcaaagttaatattaggtataacttctgtattaattatctattgattctcctgttttactggggcatgcaagatgcatttgctgatgtgcttaatgtaaaaatttggcagcctccataataattatagttaaggataacgcatagttagtcttttgccaaagttaaatacagaaaaatgtaaccaaaatataaatatatataaagggaggatgcaaggctgatttttttctctgcaactagaagagccagtgaatgctgcaagggtatatagtacagatggggtgtggtaatcatggcaattctggtgcagattgcatcactctattcctggtttgcactactttttttttaaagaaaagactgtgtatactgtatatgagctgcatattttgcactatcaacgggaagttttatattttgctctgcctgagacaatgattatcaggtgcaaaactgcagtagtctccttattgcattatttttggctacacgttcctttgtgtaatccagggcagacatcttttattgtcttacatggtctgtgatgatttagcaaaatccaaggacgcagctgaggctaatattaagccaatgaccacggatttaatcatgctggaactaaatgatacatctgtttcagtaagatgttgaaagggttccttatcttacacaaaaatataaaaattatatgtatatgatattttaataaactaaacaaatgtgcattaactaaaaaaaaaaaaaaaaaa
Translation: MMQISDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLDMEVKDEVHNTNGATNYFSRRDMHGYYILLKSIRNDIEWGVVQGEDRKKDKLSNMEISRLEDGDGEEDLEKQFHYHLSGLHTVLNKLTRKAHLLTNRYKEEIGFGSWGH
Donor tissue: neurula