ORFeome > mki67ip – XORFeome 2.0

mki67ip – XORFeome 2.0

General Information

Species: Xenopus tropicalis MKI67 (FHA domain) interacting nucleolar phosphoprotein, mRNA (cDNA clone MGC:69234 IMAGE:5307803), complete cds
Gene Symbol: mki67ip
Gene ID: 448106
ORF gb_acc: MG133227
ORF ID: 10697

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074637

Library Location

Plate ID: GDExt11006
Well Location: C11

EST Sequences

Clone: MGC:69234 IMAGE:5307803
Trimmed Sequence: ATGGCGGAGGAGTCGGTACCGAGCGGGTCGCTGCTGTCCCTGGACCCAGAACTGCAGAAGGATTTCCAGCAGAAAGTGCATGAGATCAGGAGGAAATCACAGGTCGGCGCTGTCTCCCCGGGGGTGATATACATCGGGCACATCCCCAGGGCGCTGTATGAGCCGCAGCTGCGGGAGTATTTCAGCCAGTTTGGCACCGTCACCCGGCTCAGGCTGTCCCGGAGCAAGAAGACAGGGAACAGCAAGGGATATGCCTACGTGGAGTTCGAGTGCGATGAAGTGGCTAAAATCGTTGCGGATACGATGAATAATTATCTGTTCTGTGAGCGGCTGCTGAAATGTGAATTTGTGCCCCCAGAGAAGGTGCACCCCCGGCTCTTTATTGGCTGCACCGCCAAGTTCCGTAAGCCAACAAAGCCGGCAGTCAGTCGGTACAACAAGAGGCGCAGCGAGGCGGAGCAGAAGAAGATGACGCAGCGAATGCTCTCGAAGGAGAATAAAGTGCGCAAACGACTGGCAGAGAAGGGCATCGACTACGATTTCCCAGGATTTGCGGCGCGGAGAGAAAGGAAAGAGCCGACATGCGATGCCGACACCTCAGTGAGCAGCCAGGATCCCACCCCCGTCTGTACCCCCACTGTGCTGGAAAGGAGGAAATCTGTCCGGCTGGAGCAAAACGATGAGGATGATGATGATGGGGAGGTTGTGCTGAAATTGCCCCAGGAAGATGAGGAGGTTGTGCTGAAATTGCCCCTGAAAGTCACACCAACTGCAAAGAGGCAGAAAATCTCCAAATCAGAGAAGAAAACAAAGATAAAGAAACAGAAATGA
Full Trace Sequence: ttgctcatcctgccggcaggtgtcgctgtgcgcttctcccctccctaccccacgtgttttcctgcgctgacacgccgtgccacaggctggggagatggcggaggagtcggtaccgagcgggtcgctgctgtccctggacccagaactgcagaaggatttccagcagaaagtgcatgagatcaggaggaaatcacaggtcggcgctgtctccccgggggtgatatacatcgggcacatccccagggcgctgtatgagccgcagctgcgggagtatttcagccagtttggcaccgtcacccggctcaggctgtcccggagcaagaagacagggaacagcaagggatatgcctacgtggagttcgagtgcgatgaagtggctaaaatcgttgcggatacgatgaataattatctgttctgtgagcggctgctgaaatgtgaatttgtgcccccagagaaggtgcacccccggctctttattggctgcaccgccaagttccgtaagccaacaaagccggcagtcagtcggtacaacaagaggcgcagcgaggcggagcagaagaagatgacgcagcgaatgctctcgaaggagaataaagtgcgcaaacgactggcagagaagggcatcgactacgatttcccaggatttgcggcgcggagagaaaggaaagagccgacatgcgatgccgacacctcagtgagcagccaggatcccacccccgtctgtacccccactgtgctggaaaggaggaaatctgtccggctggagcaaaacgatgaggatgatgatgatggggaggttgtgctgaaattgccccaggaagatgaggaggttgtgctgaaattgcccctgaaagtcacaccaactgcaaagaggcagaaaatctccaaatcagagaagaaaacaaagataaagaaacagaaatgacaaaaggtgtaaattccctgtccccatgtatcaaggactcgaaacctgtgtgctggctcctcccatctgtctctggcccctcctatcagtgggcccattcccaagtggacttaagttctggggttaaaggggtgcataacctggaatattccccctgctggaggcggaagcgctgtaaattgccccctattggcagcctgtgtaatgccctcttaccataattgcccctgtggcttcctcacagacattgggggggtattaatgaggggcgcaggggtttgtgctgcttttctaattaagagactgttcccggcctgtagtgccctcctgtgcagccacatttaccatctttaataaatgcctgtttgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAEESVPSGSLLSLDPELQKDFQQKVHEIRRKSQVGAVSPGVIYIGHIPRALYEPQLREYFSQFGTVTRLRLSRSKKTGNSKGYAYVEFECDEVAKIVADTMNNYLFCERLLKCEFVPPEKVHPRLFIGCTAKFRKPTKPAVSRYNKRRSEAEQKKMTQRMLSKENKVRKRLAEKGIDYDFPGFAARRERKEPTCDADTSVSSQDPTPVCTPTVLERRKSVRLEQNDEDDDDGEVVLKLPQEDEEVVLKLPLKVTPTAKRQKISKSEKKTKIKKQK
Donor tissue: gastrula