ORFeome > mknk2 – XORFeome 2.0

mknk2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis cDNA clone MGC:79688 IMAGE:6980778, complete cds
Gene Symbol: mknk2
Gene ID: undef
ORF gb_acc: MG133731
ORF ID: 11298

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080957

Library Location

Plate ID: GDExt11012
Well Location: A09

EST Sequences

Clone: MGC:79688 IMAGE:6980778
Trimmed Sequence: ATGTTGGGGCTCTGGGGGCTGTTTTTCTTCCTGCTGGGATGTGTGCAAGGGGAGCCGGTCTGTTACGACAAGATCGGGTGTTTCAGCGACGAGAAACCATGGAGCGGAACGTTAGAGCGGCCAATAGCGAGGCTGCCCAGCTCCCCGGAACATATCAACACTCGCCTCTTATTGTTCACTAGAGAAAATGCTGAAAACTTCCAAGAGCTCCGCCCCTTGAACCCCTCGGCAGTGTCACTGACAAACTTCAAGACCAGCAGGAAGAGTCGATTTATTATCCACGGATTCATCGATGAGGGAGAGGAGAACTGGCTGGTGAATATGTGCAAAGCGATGTTGAAAGTCGAAGATGTGAACTGTTTCTGCACCGACTGGAGTGGGGGGTCCCGCACCATATACACCCAGGCCGCCAATAACATCCGCGTGGTGGGGGCGGAGCTGGCCTATTTTATTGGCTACCTCTCTAGCAAGATGAAATACCCTCTGTCCAACGTGCATATTATCGGCCACAGCTTGGGCTCTCACACTGCCGGGGAGGTTGGCAAGCGGATGCCCGGCATTGGGCGAATTACTGGGCTTGATCCTGCTGGGCCGTACTTCCAGAACACCCCCATCGAGGTCAGACTGGATCCAACCGATGCCGTCTTTGTAGATGCCATTCATACCGATACCGACCCGCTGATCCCCAAAATGGGTTATGGGATGAGCCAGTCAGTCGCACACATGGATTTCTTTCCTAACGGGGGCGAGAACATGCCGGGGTGCAGCAAACCCATCCTGGCCAAGCTCTTAGACATCGATGGACTCTGGGAAGGATCCAAGGATATATTTGCCTGTAACCACCTTAGAAGCTACAAATATTACACTGAAAGTATCTCGTCTCCCGATGGATTCGTTGGATACCCCAGCACTTCATATGAAGCATTTACAAAGGGTACCGGATTCCCATGTCCCACAACTGGTTGCCCATTAATGGGCCACTATGCCGACGCCTTTTCCAGCCATGGAACAAGCGACTATTCTTATTTCTTAAACACTGGAAGTGAAAAGCCTTATTCACGCTGGAGATACAGGGTCTCCGTGAAGACCACCGGCAGCGTGAATTTCTTGGGATCCGTCCAAGTGTTGTTAAATGGCATTAAGGGCAGCACCAAAGGAGAAGAGATTGCCAGTGGGTTCATTAAACCCGGAAGCACCTACTCAGCCTTCATTGATGTCGAGGCCGACGTCGGGCCCCTCATAACCGTGAGTTTCACCTGGAAAAAGAGTCTCATCAACCTCATTCCATTCACAGTCGGCGCCGAGATGATAACCGTGCAATACGGGAAAGACGGACAGACATACGAGTTCTGTGGGAAAGACGCCGTGAGAGCAAACAACCTTCAGAGCCTGACGTCTTGTTACTCGGCCACCAAATAA
Full Trace Sequence: agatgttggggctctgggggctgtttttcttcctgctgggatgtgtgcaaggggagccggtctgttacgacaagatcgggtgtttcagcgacgagaaaccatggagcggaacgttagagcggccaatagcgaggctgcccagctccccggaacatatcaacactcgcctcttattgttcactagagaaaatgctgaaaacttccaagagctccgccccttgaacccctcggcagtgtcactgacaaacttcaagaccagcaggaagagtcgatttattatccacggattcatcgatgagggagaggagaactggctggtgaatatgtgcaaagcgatgttgaaagtcgaagatgtgaactgtttctgcaccgactggagtggggggtcccgcaccatatacacccaggccgccaataacatccgcgtggtgggggcggagctggcctattttattggctacctctctagcaagatgaaataccctctgtccaacgtgcatattatcggccacagcttgggctctcacactgccggggaggttggcaagcggatgcccggcattgggcgaattactgggcttgatcctgctgggccgtacttccagaacacccccatcgaggtcagactggatccaaccgatgccgtctttgtagatgccattcataccgataccgacccgctgatccccaaaatgggttatgggatgagccagtcagtcgcacacatggatttctttcctaacgggggcgagaacatgccggggtgcagcaaacccatcctggccaagctcttagacatcgatggactctgggaaggatccaaggatatatttgcctgtaaccaccttagaagctacaaatattacactgaaagtatctcgtctcccgatggattcgttggataccccagcacttcatatgaagcatttacaaagggtaccggattcccatgtcccacaactggttgcccattaatgggccactatgccgacgccttttccagccatggaacaagcgactattcttatttcttaaacactggaagtgaaaagccttattcacgctggagatacagggtctccgtgaagaccaccggcagcgtgaatttcttgggatccgtccaagtgttgttaaatggcattaagggcagcaccaaaggagaagagattgccagtgggttcattaaacccggaagcacctactcagccttcattgatgtcgaggccgacgtcgggcccctcataaccgtgagtttcacctggaaaaagagtctcatcaacctcattccattcacagtcggcgccgagatgataaccgtgcaatacgggaaagacggacagacatacgagttctgtgggaaagacgccgtgagagcaaacaaccttcagagcctgacgtcttgttactcggccaccaaataatctcagttatagaatataatgaataaaaaaatatttcttgtgccttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLGLWGLFFFLLGCVQGEPVCYDKIGCFSDEKPWSGTLERPIARLPSSPEHINTRLLLFTRENAENFQELRPLNPSAVSLTNFKTSRKSRFIIHGFIDEGEENWLVNMCKAMLKVEDVNCFCTDWSGGSRTIYTQAANNIRVVGAELAYFIGYLSSKMKYPLSNVHIIGHSLGSHTAGEVGKRMPGIGRITGLDPAGPYFQNTPIEVRLDPTDAVFVDAIHTDTDPLIPKMGYGMSQSVAHMDFFPNGGENMPGCSKPILAKLLDIDGLWEGSKDIFACNHLRSYKYYTESISSPDGFVGYPSTSYEAFTKGTGFPCPTTGCPLMGHYADAFSSHGTSDYSYFLNTGSEKPYSRWRYRVSVKTTGSVNFLGSVQVLLNGIKGSTKGEEIASGFIKPGSTYSAFIDVEADVGPLITVSFTWKKSLINLIPFTVGAEMITVQYGKDGQTYEFCGKDAVRANNLQSLTSCYSATK
Donor tissue: tailbud