ORFeome > mobkl2a – XORFeome 2.0

mobkl2a – XORFeome 2.0

General Information

Species: Xenopus tropicalis MOB1, Mps One Binder kinase activator-like 2A, mRNA (cDNA clone MGC:89339 IMAGE:6987768), complete cds
Gene Symbol: mobkl2a
Gene ID: 496492
ORF gb_acc: MG134358
ORF ID: 12045

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC084470

Library Location

Plate ID: GDExt11020
Well Location: B05

EST Sequences

Clone: MGC:89339 IMAGE:6987768
Trimmed Sequence: ATGTCTAATCCCCTTAAACAAGTCTTCAACAAGGACAGAACCTTCCGTCCCAAGAGAAAGTTTGAACCAGGTACTCAGCGCTTTGAGCTGCATAAGAAGGCTCAGGCATCCCTTAATGCTGGACTTGATTTGAAGTTGGCAGTTCAGCTCCCACATGGGGAGGACCTAAATGACTGGGTAGCAGTACACGTGGTGGATTTCTTTAACCGGATCAACTTAATATATGGTACCGTCAGCGACAGCTGCACTGAGCAGTCTTGCCCTGTTATGTCTGGTGGTCCGAAATATGAATACCGTTGGCAGGATGATAACCGCTATAGAAAGCCCACTGCTCTTTCTGCTCCAAAGTACATGAATTTACTTATGGACTGGATAGAAGTTCAAATAAACAACGAGGGAATATTTCCTACAAATGTCGGTACTCCATTTCCAAAGAACTTCCTTCAGGTGGTGAAAAAAATCCTCTCTAGGCTTTTTCGGGTATTTGTACATGTGTATATACATCACTTTGAGCGGATTATCCAAATGGGAGCAGAAGCACATGTCAACACTTGCTACAAACACTTTTATTACTTTGTAACTGAGTTTAATTTGATAGACACCAAGGAACTTGAACCATTGAAGGAAATGACTTCGCGGATGTGCCACTGA
Full Trace Sequence: ctagtccggagacaacaggcccgctatattttggcgggaagccaggtcgaagcgaaagaagccggcggcgaagctgacccacttcctagactggccagaggcgcgacttacagaacctacctgcagtttatcagtccttgtggttaaatcagaatttgtctttagaccactgctagaaatcaagggatttaattgctgctatgtctaatccccttaaacaagtcttcaacaaggacagaaccttccgtcccaagagaaagtttgaaccaggtactcagcgctttgagctgcataagaaggctcaggcatcccttaatgctggacttgatttgaagttggcagttcagctcccacatggggaggacctaaatgactgggtagcagtacacgtggtggatttctttaaccggatcaacttaatatatggtaccgtcagcgacagctgcactgagcagtcttgccctgttatgtctggtggtccgaaatatgaataccgttggcaggatgataaccgctatagaaagcccactgctctttctgctccaaagtacatgaatttacttatggactggatagaagttcaaataaacaacgagggaatatttcctacaaatgtcggtactccatttccaaagaacttccttcaggtggtgaaaaaaatcctctctaggctttttcgggtatttgtacatgtgtatatacatcactttgagcggattatccaaatgggagcagaagcacatgtcaacacttgctacaaacacttttattactttgtaactgagtttaatttgatagacaccaaggaacttgaaccattgaaggaaatgacttcgcggatgtgccactgacaaaggacttattcttggttttatgtttccacatcctgctgatgcctgtggagcctgtcacattactgctgaacatgtacccctctgccagcagagaggtcacccagaagtgcggactctatcccttttgataaaacgtagaaatctgaatgtgatttattttttaaatctatttttaaatcgctggcacttcataaaacctgtcatatttcaggacaactcttttctatcgcctgtatatcaatttctatgcatagatttattttttgtatgtttgtagcatttcattctgttgtgttgcataggttaaatgtgcaggaaacctcatacacattcctgtactgtaatcacaagcatataaaggaacattaccacttaaaaaatgcagtactgcttttagggaccaaatattaggctttttaccagggccttctgtatttgcagacttgctgatacttgtagggatttcaccatgggactatgccttgttatcttggtttgggagcaatacgctagcataccccttgtttcattgaggcttgtggtacatgcaagtgcatcagagggctgcatgtctttttctgaatgatatgagttatcacagtgaagtttctaactaaatccttgcactgcttccagcatatactgttatgccacttgtatgtcacagtagatattaaggaagcatctggtaactgccagaccaagcattttacttgtgctgtaagtctgttatctctatgagccaagcatatgaattccatgcatatgctgctaattgttcatttgtgccttatatagttctaaggagagaatacttttgtatataatgcactgaatacacatgcagtagttacggagagaaactgcatttttagaaagtgtaattcatttcatcatagctgtataactgactaaagtgatttataatacaggattttagtggattgttcccaactatacattagggaaatgaattttctgaaaacatgtcttcctaaagaatttatggaccatccacatgtcctcccccagtagcctgatacatgtgtgcaccttctttctttttttatctttttattgtgagaatagtgaataacgttttcatattactctcttccacagtagcaattggttataatacttttctatgtttagacttcccagcatgcatatctggtttacccataatttccatattttctggaaatattctggctgaacctatggctttgcacagaatattgccacttttgtgttttactttgctgtttacttcagtgagttttggctatttgttgtattgataaaaacaatagaataggtaggattcacttctggccacctgacaattgccatcctcagctgggacactgacactagaaggtgggtgttggatacaaggcatccagattcccattgatctggcagtataagcagtgcacacaataaatagaagtttatattctttcaaacacagctactggggagctttatttagactcatttggaagtagacctttacatacagggtccagggtggtggggtactccccccagtccctgtgctttttttttttttttttttaaagcatggaaattaatgtgttctgagtagttgtgctcactgatgaatagcttatacattcttttttgcccatatagctggtcattttgttggccaaataaaactttctccttcagaaagaaatcatgacggagctctatgaaaaggaagaaaaataactgagaaatatgaatctgtttaaaggaacttaatgttttgtattgagaactgcatcacacagcttagtaaaggtattattattagatattaatgagcagcagttgggttattaaaacacatgttagtgaaagatagatgtttatagatagtatgtttattgagaaaaatcctaccctgacagtctaaatctgattccttctctcacatttgaaatgattatattaaagacaaatggagtgatgatgttccccctatgagattaaagtagttgtttctacttcactaaacatatattttagagtaattatcccaaactatagatctttcattagtggaagtagctgtttctcttatcaatgtcattaagctggtgatgtaaatgaatgtttctttcatttttaaatcaatcaggaattataaactagtgtagctaggtcgatttgctggcatatagtcgccgttcttcaatgcctgttatttccacacattcccaattctttcactagatttatttattaaatgcactttttatgtaaccactaataactatctgtgccgttttgctaccattgtacaaaggaagcgtcatggcattgtttatatggggtgaggcattcacactcagctgggtacaagtgatgcccctaaaagttttgaatgcttttataaactggttttcatgcacatttcattcaaagaatgttttatggtttaaaattgcaggtggtccacctttttaaacttggaaatgtacaaagattttattttcatacacaaggccttttcaagtgcctagtttttgctaaccactgtcacaagcatcctctgtttttattatagtgcaaataaattatgcagtgtctaaaatgaaaaaaaaaaaaaaaaa
Translation: MSNPLKQVFNKDRTFRPKRKFEPGTQRFELHKKAQASLNAGLDLKLAVQLPHGEDLNDWVAVHVVDFFNRINLIYGTVSDSCTEQSCPVMSGGPKYEYRWQDDNRYRKPTALSAPKYMNLLMDWIEVQINNEGIFPTNVGTPFPKNFLQVVKKILSRLFRVFVHVYIHHFERIIQMGAEAHVNTCYKHFYYFVTEFNLIDTKELEPLKEMTSRMCH
Donor tissue: gastrula