ORFeome > myl1 – XORFeome 2.0

myl1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis myosin, light chain 1, alkali; skeletal, fast, mRNA (cDNA clone MGC:75774 IMAGE:5381870), complete cds
Gene Symbol: myl1
Gene ID: 394551
ORF gb_acc: MG132928
ORF ID: 10295

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061302

Library Location

Plate ID: GDExt11004
Well Location: F03

EST Sequences

Clone: MGC:75774 IMAGE:5381870
Trimmed Sequence: ATGGCACCCAAGAAGGATGTGAAGAAACCTGAGGCTAAACCCGCTGCTGCCCCAGCACCTGCACCTGCCCCAGAACCAGAAAAGCCCAAACAACCTGCATTCGATCTGTCCAGCGTCAAGATCGAGTTTTCCCAGGATCAGCAGGATGACTTCAAAGAGGCTTTCCTGCTCTTTGACAGGACAGGAGACAGCAAAATTGCCCTCAACCAGGTAGCTGATGTGATGAGAGCTCTGGGACAGAACCCCACAAATGCTGAGGTCAAGAAGGTCCTGGGCAACCCCTCTGCTGAAGAGATGAACGCCAAGAAGATTGAGTTTGAGCAGTTCCTGCCCATGATGCAGGCCGTTGCCAACAACAAGGACCAGGGCTCCTTTGAAGACTTTGTTGAGGGTCTCCGTGTCTTTGACAAGGAAGGCAACGGCACTGTTATGGGTGCTGAGCTTCGTCACGTACTGGCCACTCTGGGTGAGAAGATGAGGGAGGAGGAAGTAGAAGCTCTTCTGGCAGGTCAGGAAGACTCCAACGGCTGTATCAACTATGAAGCCTTTGTGAAACACATCATGTCCGTCTAA
Full Trace Sequence: ttctaggctctgggctgaagatcatcctggtcttacctcctccctcaagaaacacttgggctgctttctttttggattccttttttatttctaccccttgttaaactaaaaccagcacaatggcacccaagaaggatgtgaagaaacctgaggctaaacccgctgctgccccagcacctgcacctgccccagaaccagaaaagcccaaacaacctgcattcgatctgtccagcgtcaagatcgagttttcccaggatcagcaggatgacttcaaagaggctttcctgctctttgacaggacaggagacagcaaaattgccctcaaccaggtagctgatgtgatgagagctctgggacagaaccccacaaatgctgaggtcaagaaggtcctgggcaacccctctgctgaagagatgaacgccaagaagattgagtttgagcagttcctgcccatgatgcaggccgttgccaacaacaaggaccagggctcctttgaagactttgttgagggtctccgtgtctttgacaaggaaggcaacggcactgttatgggtgctgagcttcgtcacgtactggccactctgggtgagaagatgagggaggaggaagtagaagctcttctggcaggtcaggaagactccaacggctgtatcaactatgaagcctttgtgaaacacatcatgtccgtctaagcggatatctcaagaactgtcacaagaatgtctcagaacaccgggagcaccagaactgtacaaaaaccagcaactggttacaactaactatacggaactgaactgtacaatacacccaccattttttttttatttttcatcactggaatttcaacatttactttcatgaaccctgccaatatttaaaacggatcaaacaggacgatgcaacccccgacaaagttggtggcgaaatcttctaggcagatctgtgtaccataccatggagcactgtaaaaaaaaaaaagacatgtcaataaacacctttgctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAPKKDVKKPEAKPAAAPAPAPAPEPEKPKQPAFDLSSVKIEFSQDQQDDFKEAFLLFDRTGDSKIALNQVADVMRALGQNPTNAEVKKVLGNPSAEEMNAKKIEFEQFLPMMQAVANNKDQGSFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMREEEVEALLAGQEDSNGCINYEAFVKHIMSV
Donor tissue: tadpole