ORFeome > myl2 – XORFeome 2.0

myl2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis fast skeletal myosin light chain 2, mRNA (cDNA clone MGC:75669 IMAGE:5379964), complete cds
Gene Symbol: myl2
Gene ID: 394763
ORF gb_acc: MG132819
ORF ID: 10166

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061602

Library Location

Plate ID: GDExt11002
Well Location: A08

EST Sequences

Clone: MGC:75669 IMAGE:5379964
Trimmed Sequence: ATGGCACCAGCAAAGAAGGCCAAGAGAAAGGCAGCAGAAGGTGGATCTTCCAATGTGTTGTCCATGTTTGACCAAACCCAGATCCAGGAGTTCAAGGAGGCTTTCACAGTGATTGATCAGAACAGAGACGGCATCATTGACAAGGAAGACCTGAGGGACACATTCGCAGCTATGGGCCGCCTGAACGTGAAGAATGAAGAGTTGGAAGAGATGGTCAAAGAGGCATCTGGCCCCATCAACTTCACCGTCTTCCTGACCATGTTCGGCGAGAAGCTCAAGGGTGCTGATCCCGAAGACGTTATCACTGGGGCATTCAAGGTGCTTGATCCTGAGGCCAAAGGATCCATCAAGAAGCAGTTCCTTGAGGAACTCCTTACCACACAGTGTGACAGATTCACCCCAGAGGAGATCAAGAACATGTGGACAGCGTTCCCCCCTGATGTTGCTGGCAACGTAGACTACAAGAACATCTGCTATGTCATCACCCACGGAGAGGACAAAGACCAGGAATAA
Full Trace Sequence: ttctgatcaggacaagcaccaagctcaaccgaggacatggcaccagcaaagaaggccaagagaaaggcagcagaaggtggatcttccaatgtgttgtccatgtttgaccaaacccagatccaggagttcaaggaggctttcacagtgattgatcagaacagagacggcatcattgacaaggaagacctgagggacacattcgcagctatgggccgcctgaacgtgaagaatgaagagttggaagagatggtcaaagaggcatctggccccatcaacttcaccgtcttcctgaccatgttcggcgagaagctcaagggtgctgatcccgaagacgttatcactggggcattcaaggtgcttgatcctgaggccaaaggatccatcaagaagcagttccttgaggaactccttaccacacagtgtgacagattcaccccagaggagatcaagaacatgtggacagcgttcccccctgatgttgctggcaacgtagactacaagaacatctgctatgtcatcacccacggagaggacaaagaccaggaataaacaggcccagtcttgccctcctgatggagggggtgcgccatcacgcccagcaccaaccttgctgtatattgcgtcttattttataaactcatcccatcagagacacaactgtaatttatttcttctaggggtggtctgaaaggggacccctctctgttgttcttgtcccctttctcgctgtccctttccctcctcttttaccctccctcacatttcgctctttgatgtcttaaactggaactctggagccctcaagggaagaacaataaagtcaactttttattcaaaaaaaaaaaaaaaaaaaaa
Translation: MAPAKKAKRKAAEGGSSNVLSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELEEMVKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEAKGSIKKQFLEELLTTQCDRFTPEEIKNMWTAFPPDVAGNVDYKNICYVITHGEDKDQE
Donor tissue: tadpole