ORFeome > ndrg4 – XORFeome 2.0

ndrg4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis NDRG family member 4, mRNA (cDNA clone MGC:89166 IMAGE:7016221), complete cds
Gene Symbol: ndrg4
Gene ID: 448335
ORF gb_acc: MG134185
ORF ID: 11830

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075414

Library Location

Plate ID: GDExt11018
Well Location: F06

EST Sequences

Clone: MGC:89166 IMAGE:7016221
Trimmed Sequence: ATGAAGCTGCTGGGGCATAAGATAGAGCTCTGGGCAGGCTTGCTGCTGCCAGACGTCAGCATATCTGGGATGAGTGAGCTGCGATTTCCAGAGGAGAAACCTCTTCTCAGAGGCCAAGACACAGAAATGGAGTCCGCTGACACCTTTCTGTCTGCTGCTGACACAGACTGGAAAGAACATGACATTGAAACCCCATATGGAATGCTACATGTGGTTATTCGAGGGACTCCAAAGGGCAATCGGCCTGCGATTCTTACCTACCACGATGTGGGGCTGAACCACAAGCTTTGTTTCAACACCTTCTTTAACTATGAGGATATGCAGGAGATAACTAAGCACTTTGTGGTATGCCATGTGGATGCCCCGGGGCAGCAGGTGGGGGCATCACAGTTCCCTCAGGGGTACCAATATCCCACAATGGAACAACTGGCAGCCATGCTACCCAGTGTCATGCAGCACTTTGGATTTCAAAGTATAATTGGCATTGGTGTTGGAGCAGGAGCCTATGTCCTTGCAAAATTTGCTCTGATTTTCCCAGAGTTAGTGGAAGGCATGGTTCTGGTTAACATTGATCCAAACGGAAAAGGGTGGATTGACTGGGCAGCCTCCAAGCTCTCTGGGCTCACCAGCTCCCTGCCAGAAACTGTGCTGTCTCATCTATTCAGCCAGGAGGAGTTGATGAATAACACAGAACTTGTGCAGAACTACCGGCAGCAGATCAGCAGCTGTGTGAACCAGAGCAATTTGCAACTATTCTGGAACATGTACAACAGTCGAAGAGATCTGGAAATGAGTCGTCCTGGAACTGTTCCAAATGCTAAGACTTTGAGGGCACCAGTGATGTTGGTTGTTGGCGATAATGCTCCAGCTGAAGACTGTGTGGTTGAATGTAACTCAAAGCTGGACCCAACAAACACAACATTCCTAAAGATGGCTGATTCTGGTGGCCTTCCACAGGTGACACAGCCTGGAAAACTGACAGAAGCATTTAAATATTTCCTACAAGGCATGGGATACATTGCTTCCCTGAAGGATCGGAGACAGAGTGCAAGTGCAGGAGCAGTGCCCTCAGCAAGTATGACCCGGCTTGCCCGCTCCCGCACAGCTTCTCTCACCAGTGCTAGCTCTGTGGATGGAGCCCGTCCTCGACCCTGCACCCAATCTGAAAGCAGTGATGGCATTGGCCAAATCAATCACACAATGGAGGTTTCCTGCTGA
Full Trace Sequence: ttcctttcggtcattcctgcacacactcctcttattttgtattgttctacctattgctcatttaatttactagccatataagactgtataaagcttgctgtctcctttgctttgctggacagctccctgccttcttcattcccccttcctgcttctccctctcagacagctacatcaggaggtctctcactctgcctgaagcagttatttgctgcgttgtctgcagagataatgaagctgctggggcataagatagagctctgggcaggcttgctgctgccagacgtcagcatatctgggatgagtgagctgcgatttccagaggagaaacctcttctcagaggccaagacacagaaatggagtccgctgacacctttctgtctgctgctgacacagactggaaagaacatgacattgaaaccccatatggaatgctacatgtggttattcgagggactccaaagggcaatcggcctgcgattcttacctaccacgatgtggggctgaaccacaagctttgtttcaacaccttctttaactatgaggatatgcaggagataactaagcactttgtggtatgccatgtggatgccccggggcagcaggtgggggcatcacagttccctcaggggtaccaatatcccacaatggaacaactggcagccatgctacccagtgtcatgcagcactttggatttcaaagtataattggcattggtgttggagcaggagcctatgtccttgcaaaatttgctctgattttcccagagttagtggaaggcatggttctggttaacattgatccaaacggaaaagggtggattgactgggcagcctccaagctctctgggctcaccagctccctgccagaaactgtgctgtctcatctattcagccaggaggagttgatgaataacacagaacttgtgcagaactaccggcagcagatcagcagctgtgtgaaccagagcaatttgcaactattctggaacatgtacaacagtcgaagagatctggaaatgagtcgtcctggaactgttccaaatgctaagactttgagggcaccagtgatgttggttgttggcgataatgctccagctgaagactgtgtggttgaatgtaactcaaagctggacccaacaaacacaacattcctaaagatggctgattctggtggccttccacaggtgacacagcctggaaaactgacagaagcatttaaatatttcctacaaggcatgggatacattgcttccctgaaggatcggagacagagtgcaagtgcaggagcagtgccctcagcaagtatgacccggcttgcccgctcccgcacagcttctctcaccagtgctagctctgtggatggagcccgtcctcgaccctgcacccaatctgaaagcagtgatggcattggccaaatcaatcacacaatggaggtttcctgctgaactcctgagtaccaatgccctttaaccctctaatcccccatttacgccattcattatccttctttactggttttgcttcctgttcccccctttaaacagcgtctggcgtttcttggggatcttataatcagaatgacagcgcatcatcttgcatctggtccagtgcttttagggcttattcctgcgattggatgtaagaggcaccccaaaatgagaaaggggaataagaggaggtagaaatatggttaaatgtcagccaggcatcttattacagtaaagtgcattaggagtctgatacaatgggatttatttggtgctctgcacaaagttaaaaagagttaagtggtcctcacaaaaaggcctttacaaaaattttagataataaattctatttctttaggaggaagacaaggtcttctcaagaaattgatatcatgaaatttgcttcttggtgtgacagcgcagagcaccagtttaaacaattcctcagggaaatcctgcagtgaggggttttaggagacctttattatgaggcaatggcaagatgtcaattcaggtacagattttggtttcctccaaattattttgagaaaggttttccttaagtctgtatggttttccatcagcactggtttgaaaccattgcctaggattgctaattggcatgtcttgaggaactgaatatatgaatataatcatatctaaagtggtaaagagatggtctacagatgtgtgcattatgggccagagttgagatgtaggttacagtttagcacctaaaagccttgagttgcatatctgagtgacaaagatacataaaggtatacgtggaatagatctgacatctcctttctattataggtgttgttaagctttttttctagctgatgtactgcatggtgttcggaccatgcagtattccaaacacgtaaacccagctttggttccattttgatggctgagagtgtaaagttgtaagcagagaccatgattacatgaaagcaggattgaaaataaagcagatgttttggtaattttataaactggaacctttgtgcggatcatactgatttgttaggtcttctgctttaaggttattaggtggtgagtgtctcttcctgtagtcagttgtatacagcaatattattatgttgtactgggatcggaatcagccaacattcaaagtatgtaacaataaaaagtggtcaactacaaataacaatattacagagtcagggaattaagggtatgtaatcctcaagtcaccatgagattcattaacaaggacctacagatcacctagagaaatggcacacattctttaaatatttagtcttttcatgactccatagagtctaaacctttagaattccattattattatgttttcagccggtacattatgtgtgggtatgcagttctcctggaggctgtataaagtaatggtctgcaagtcttctcaagattggataatagtgatcttgaggtttgctggaaatgattgtatatagaagagtgacatggatttgtaggactgtagcagtggccttcaggaatataggacagaataagacatacagtacatgtctttttataggaaatacatttgatctcagttagactggccataaagacacaagcaaaacatacttaatagatgtctgtaactagaaactgtgagagagaaataaggcaaaatatgctgtttggcagcaatgtaaaagcagtgaaagaagctccagcacacaggtgagcagtgacaccagtagaggattgtctatgctttcagcaatgctctgcacaggctatgtgatgctatgagattcctatagcagactagttatttatatacgcaatgcacttcttgtctccagcatgcaaaggattaagcaatgctagacaggtctgtggcaaggggttacctcttttttacatcatttgaaaaagttttaaagccgtgtcctgtctcccctgcatcttcatcttagtgtatctccctctacctctttccagaaccttacttgtcatatgcgtgttctgccaaactatatatatatttctataaatacctatacataatacatttaggaatcttccataacccatctttacctgtggttaccatttaatgtgttctgtaactttttttaaggtggaatttaatggatcctggtaaatatttctcctgtctctgtgcacagtgattctgttatacatatacaatatataggaatactctttggtgtgtgcattatggtggttgatgcttctagttgcattaaagccatcattacaaatactcctccttgaactgatgagagatacaagtacattcatttgttgggaaatctaaataaaacacttaaacctgcaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MKLLGHKIELWAGLLLPDVSISGMSELRFPEEKPLLRGQDTEMESADTFLSAADTDWKEHDIETPYGMLHVVIRGTPKGNRPAILTYHDVGLNHKLCFNTFFNYEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQYPTMEQLAAMLPSVMQHFGFQSIIGIGVGAGAYVLAKFALIFPELVEGMVLVNIDPNGKGWIDWAASKLSGLTSSLPETVLSHLFSQEELMNNTELVQNYRQQISSCVNQSNLQLFWNMYNSRRDLEMSRPGTVPNAKTLRAPVMLVVGDNAPAEDCVVECNSKLDPTNTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIASLKDRRQSASAGAVPSASMTRLARSRTASLTSASSVDGARPRPCTQSESSDGIGQINHTMEVSC
Donor tissue: