ORFeome > ndufa13 – XORFeome 2.0

ndufa13 – XORFeome 2.0

General Information

Species: Xenopus tropicalis NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13, mRNA (cDNA clone MGC:75717 IMAGE:5380852), complete cds
Gene Symbol: ndufa13
Gene ID: 394495
ORF gb_acc:
ORF ID: 10326

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059742

Library Location

Plate ID: GDExt11003
Well Location: H10

EST Sequences

Clone: MGC:75717 IMAGE:5380852
Trimmed Sequence: ATGGCGGCGTCCAAGGTGAAGCAGGACTTGCCACCTCCTGGGGGCTATGGTCCTGTGGATTACAAGAGGAATTTACCCCGCCGAGGACTAAGCGGGTACTCGATGTTTGCTCTGGGTGCTGGGGTCATGCTTTTTGGATACTGGAGCATTTTTCGCTGGAACAGAGAAAGGAGACGATTGCAGATTGAAGATCTAGAGACACGTGTTGCCCTTTTGCCCCTATTCCAAGCAGAGGCCGACAGACGAATATTAAGGTTGATGCAACAGAATTTAGAAGAGGAGGCCATTTTAATGAAAGATGTTCCTGGTTGGAAGGTTGGAGAGTCTACTTTCCACACAGATCGCTGGGTGACTCCCACACTTAATGAGTTGTACAACCTTAGGCCAAAGGAAGAACTTATTAAAAAGAAGTTTGGTTTCCAGTGGTATGTGTAA
Full Trace Sequence: cttcgacaggggcttaactaaagatggcggcgtccaaggtgaagcaggacttgccacctcctgggggctatggtcctgtggattacaagaggaatttaccccgccgaggactaagcgggtactcgatgtttgctctgggtgctggggtcatgctttttggatactggagcatttttcgctggaacagagaaaggagacgattgcagattgaagatctagagacacgtgttgcccttttgcccctattccaagcagaggccgacagacgaatattaaggttgatgcaacagaatttagaagaggaggccattttaatgaaagatgttcctggttggaaggttggagagtctactttccacacagatcgctgggtgactcccacacttaatgagttgtacaaccttaggccaaaggaagaacttattaaaaagaagtttggtttccagtggtatgtgtaacttgtacttcttgtgcaatacttttgtctttatcagaataaaatccttccaagactcaaaaaaaaaaaaaaa
Translation: MAASKVKQDLPPPGGYGPVDYKRNLPRRGLSGYSMFALGAGVMLFGYWSIFRWNRERRRLQIEDLETRVALLPLFQAEADRRILRLMQQNLEEEAILMKDVPGWKVGESTFHTDRWVTPTLNELYNLRPKEELIKKKFGFQWYV
Donor tissue: tadpole