ORFeome > nfya – XORFeome 2.0

nfya – XORFeome 2.0

General Information

Species: Xenopus tropicalis nuclear transcription factor Y, alpha, mRNA (cDNA clone MGC:76011 IMAGE:5384634), complete cds
Gene Symbol: nfya
Gene ID: 394530
ORF gb_acc: MG133475
ORF ID: 10997

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061417

Library Location

Plate ID: GDExt11009
Well Location: G09

EST Sequences

Clone: MGC:76011 IMAGE:5384634
Trimmed Sequence: ATGGAGCAATTTACAAGCAGTAACGGCTCCCCAGAGCAAATAGTGGTTCAGGCTGGACAGATCCAGCAGCAGGTACAAGGTCAACCACTTATGGTGCAAGTCAGTGGGGGGCAACTGATCACCTCTACTGGACAGCCAATCATGGTACAAGCCATGGGTGGCCAAGGTCAGACTCTTATGCAGGTGCCGGTATCTGGATCCCAAGGACTGCAGCAGATACAGCTGGTCCAACCAGGGCAGATTCAGATTCAAGGAGGACAGGCTGTACAGGTTCAAGCCCAGCAAGGGCAGCCCCAGCAGATTATTATACAGCAACCACAGACAGCTGTAACTGCAGGACAAAGTCAGAACCAGCAGCAGATAGCTGTTCAGGGTCAGCAAGTTGCACAGACAGCTGAAGGTCAGACTATAGTTTACCAGCCTGTAAATGCAGACGGAACCATTCTTCAGCAAGGAATGATCACCATACCTGCTGCTAGCCTAGCTGGAGCTCAGATTGTGCAGGCTGGAGCCAACACCAATACCACCAACAGTGGCCAAGGAACTGTGACAGTTACTCTTCCTGTGACTGGCAACATGATGAACTCTGGAGGCATGGTGATGATGGTACCTGGTGCTGGCACTGTACCCACTCTACAGAGGATACCACTGCCTGGTGCCGAGATGCTTGAGGAAGAGCCACTTTACGTGAATGCTAAGCAGTATCACCGAATCTTAAAGAGACGACAAGCACGAGCTAAATTGGAGGCAGAAGGGAAAATCCCAAAAGAGAGGAGAAAATATTTGCATGAGTCCAGGCATCGCCATGCTATGGCTAGAAAGAGAGGGGATGGTGGACGTTTTTTCTCCCCTAAAGAAAAAGAGAGTCATCATTTACAGGACGTGGAATTTCATTAG
Full Trace Sequence: gtggcgttgtattttttgtgaaaccaggatcctgctacaagcgtgcagttaacagcttttcgagaggtgtgcctttaaactgcattgtgtagtctttctaaggagcagatggagcaatttacaagcagtaacggctccccagagcaaatagtggttcaggctggacagatccagcagcaggtacaaggtcaaccacttatggtgcaagtcagtggggggcaactgatcacctctactggacagccaatcatggtacaagccatgggtggccaaggtcagactcttatgcaggtgccggtatctggatcccaaggactgcagcagatacagctggtccaaccagggcagattcagattcaaggaggacaggctgtacaggttcaagcccagcaagggcagccccagcagattattatacagcaaccacagacagctgtaactgcaggacaaagtcagaaccagcagcagatagctgttcagggtcagcaagttgcacagacagctgaaggtcagactatagtttaccagcctgtaaatgcagacggaaccattcttcagcaaggaatgatcaccatacctgctgctagcctagctggagctcagattgtgcaggctggagccaacaccaataccaccaacagtggccaaggaactgtgacagttactcttcctgtgactggcaacatgatgaactctggaggcatggtgatgatggtacctggtgctggcactgtacccactctacagaggataccactgcctggtgccgagatgcttgaggaagagccactttacgtgaatgctaagcagtatcaccgaatcttaaagagacgacaagcacgagctaaattggaggcagaagggaaaatcccaaaagagaggagaaaatatttgcatgagtccaggcatcgccatgctatggctagaaagagaggggatggtggacgttttttctcccctaaagaaaaagagagtcatcatttacaggacgtggaatttcattagatgcaaggtggagctgatctgagaatatgttgcatttccacttcagaaatatgttgacacatatggagtatggggtgcatagtattttttatcccaacatgattcatctcagggaagagaagttaaccagatgatgccatcagtttgatgtcacaaggaatgcaacaaatgacagttaaatgatatcttcctgttaatatttgatctatttgctccctgtgcactgctctgataatgaaatctcataacaaaatggcttaatttgcagactgcatgcaggttttgaatcctttaccacaaggggttatcaactgtgtagctgtctgtttcttggacaagtcttccatccaagctgtcgttgccatatgggctaataaaggagtattaagggaacttcattactagaggtgcttactaagagagcatgctatgacagtgaaactttaaaggcttttattccaataagtatcagacagtgtattgtatgttgtaattgaaacttttgatgtatttaaagagttatttttttccgctttagaagtaatctagttcatgtttgtatagctatacattacctctgcttcattttaggggggatttgactagggctgttgactacattgcattttgatattgcattttcaagattggtaaatgtattttgaggtaatagtttctttacttctgcaatttcgtacataaaagattataaatgccagtaggaatttccacatatcaaagtcaggttttgttttctgcattatgttttccccattctctaggtatttattagacctagtttggctaaccgcagacagtacgttcgtgaacttgcctatgtcagctaaagatcagatagtctgcagaattaggccagtgtagtactcagaaatttgttacttatgaaaatctttgtaaatatcctttttttacatttttttcacaacatcattttttctgttagctgtatttgtaagtactgtgtacctcacccagctaataaaactttctaactacaaaaaaaaaaaaaaaaagaaaaaaa
Translation: MEQFTSSNGSPEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAMGGQGQTLMQVPVSGSQGLQQIQLVQPGQIQIQGGQAVQVQAQQGQPQQIIIQQPQTAVTAGQSQNQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQGMITIPAASLAGAQIVQAGANTNTTNSGQGTVTVTLPVTGNMMNSGGMVMMVPGAGTVPTLQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGDGGRFFSPKEKESHHLQDVEFH
Donor tissue: neurula