ORFeome > nfyc – XORFeome 2.0

nfyc – XORFeome 2.0

General Information

Species: Xenopus tropicalis nuclear transcription factor Y, gamma, mRNA (cDNA clone MGC:75886 IMAGE:5383235), complete cds
Gene Symbol: nfyc
Gene ID: 394813
ORF gb_acc: MG133032
ORF ID: 10424

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC063353

Library Location

Plate ID: GDExt11004
Well Location: C11

EST Sequences

Clone: MGC:75886 IMAGE:5383235
Trimmed Sequence: ATGTCTGCAGATGGGTCATTCGGACCAAGCAGCAGTGATGCACAGCAAAGCCTTCAGTCTTTCTGGCCAAGGGTTATGGAGGAGATACGCAATTTGACAGTGAAAGATTTCAGAGTTCAGGACCTCCCTCTGGCTCGCATAAAAAAGATCATGAAACTTGATGAAGATGTGAAGATGATCAGTGCTGAAGCCCCAGTTTTGTTTGCCAAAGCTGCACAGATTTTTATAACAGAGTTAACCCTACGTGCCTGGATTCACACAGAGGACAACAAAAGGAGAACTCTTCAGAGAAATGACATTGCTATGGCAATCACAAAGTTTGATCAGTTTGACTTTCTTATTGACATTGTCCCCAGGGATGAATTAAAACCTCCAAAGCGCCAGGAAGAAGTCCGGCAGACTGTGAACTCCACGGAGCCAGTTCAGTACTACTTCACTCTAGCACAGCAGCCAGCTGCTGTACAAGTGCAAGGACAGACAGCTGGTCAGCAAACTACATCGTCCACCACCACCCTCCAGCCCGGTCAGATTATCATAGCTCAGCCACAGCAAGGCCAGAATGCACCAGTTACCATGCAGGTTGGAGAGGGACAGCAGGTACAGATTGTGCAGGCACAGCCTCAGGGACAAAGTCAGCAAGGGCAGAGTGGAGCTGGGCAGACCATGCAAGTCATGCAACAAATAATCACCAACACAGGAGAGATTCAGCAGATCCCGGTTCAGCTGAATACAGGGCAACTGCAATATATACGACTAGCCCAGCCAGTGTCCGGAACACAAGTTGTTCAGGGACAGATCCAGACCCTAACAGCTAATGCACAGCAGATTGCACAAGCAGATGTCCAGCAGGGACAGCAGCAGTTCAGCCAGTTTACCGATGGCCAGCAATTGTACCAGATTCAGCAAGTCACCATGCCAGCTGGGCAAGACATCGCACAGCCACTGTTCATCCAGTCCAGCGGGCAGGCATCTGATGGACAAACTACTCAGGTCACAGGGGACTGA
Full Trace Sequence: gttaacgactgtctccttttgaagtttttgtcccttacaaacgattattcagccggtggaccttggcgtgtttaggaagctgtaggaaaagccgatcattggtacgctgcaccgaggcagccggcctgaaacatgtctgcagatgggtcattcggaccaagcagcagtgatgcacagcaaagccttcagtctttctggccaagggttatggaggagatacgcaatttgacagtgaaagatttcagagttcaggacctccctctggctcgcataaaaaagatcatgaaacttgatgaagatgtgaagatgatcagtgctgaagccccagttttgtttgccaaagctgcacagatttttataacagagttaaccctacgtgcctggattcacacagaggacaacaaaaggagaactcttcagagaaatgacattgctatggcaatcacaaagtttgatcagtttgactttcttattgacattgtccccagggatgaattaaaacctccaaagcgccaggaagaagtccggcagactgtgaactccacggagccagttcagtactacttcactctagcacagcagccagctgctgtacaagtgcaaggacagacagctggtcagcaaactacatcgtccaccaccaccctccagcccggtcagattatcatagctcagccacagcaaggccagaatgcaccagttaccatgcaggttggagagggacagcaggtacagattgtgcaggcacagcctcagggacaaagtcagcaagggcagagtggagctgggcagaccatgcaagtcatgcaacaaataatcaccaacacaggagagattcagcagatcccggttcagctgaatacagggcaactgcaatatatacgactagcccagccagtgtccggaacacaagttgttcagggacagatccagaccctaacagctaatgcacagcagattgcacaagcagatgtccagcagggacagcagcagttcagccagtttaccgatggccagcaattgtaccagattcagcaagtcaccatgccagctgggcaagacatcgcacagccactgttcatccagtccagcgggcaggcatctgatggacaaactactcaggtcacaggggactgagcaggcaaagcttgaggaaggaactggaaaaggaacgcagacacatgtacacatatatacacgtactcagacgtgccgacaaatgcacacactcgtgtggtataggctctactggcactcaaagggataaagggaaattgtttgcagttcatgactagtgccagccttcaggatagctggggcccgaattggttctgttgtgcatcttgccctgtgaggggaccattctacggagggggtttgttgtgaatacgctgacaaaacagaagcacgagaaacacctggatgagagatccctacagtgtatttcccatgatcacatccagttgcactaattatacttgtgatgcagatttggattttccatttatttaaaagcatagtacccttttaaatgtaataataaatgaggccatgaaccatgagtttcaatgttagatgagccacagacaatttgtagagaaacaccagataacccgtttcagttgggatccgcagggcacccttctttgcaaagcaacgctgtcaattctttttgccgtttccttttccggatgaagcagtaacaaagcatttcctgccgctcttgttcatgatctgattaaatgagccttcctcccacacctgccactgacagcgctgtgttagccggaacgcacgttccgccagtataaagccttgccattacatttggactggatacgtatctattgaggaagtaatgtatggtgtgtatggggggtggggtcagtttttattattaatactaatttctttgtctttttaatgtattgctgtagtctgctttgtgtacacagaacaattctgcacagacagcaataaactttttagatacagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSADGSFGPSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQDLPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQTVNSTEPVQYYFTLAQQPAAVQVQGQTAGQQTTSSTTTLQPGQIIIAQPQQGQNAPVTMQVGEGQQVQIVQAQPQGQSQQGQSGAGQTMQVMQQIITNTGEIQQIPVQLNTGQLQYIRLAQPVSGTQVVQGQIQTLTANAQQIAQADVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDIAQPLFIQSSGQASDGQTTQVTGD
Donor tissue: neurula