ORFeome > nhp2l1 – XORFeome 2.0

nhp2l1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis NHP2-like protein 1, mRNA (cDNA clone MGC:75724 IMAGE:5380980), complete cds
Gene Symbol: nhp2l1
Gene ID: 394590
ORF gb_acc: MG132938
ORF ID: 10307

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061279

Library Location

Plate ID: GDExt11004
Well Location: G03

EST Sequences

Clone: MGC:75724 IMAGE:5380980
Trimmed Sequence: ATGACTGAACCAGAAGTGAACCCTAAAGCCTACCCACTTGCAGATGCCCAGCTCACAAAAACCCTTTTGGATCTTGTTCAGCAAGCCGCTAATTACAAGCAGCTTCGCAAGGGTGCTAATGAAGCTACAAAAACCCTAAACAGAGGCATAGCTGAGTTTATAGTCATGGCGGCTGATGCAGAACCCTTGGAAATTATTCTACACCTCCCACTCCTGTGTGAAGACAAGAATGTCCCCTATGTGTTTGTGCGCTCCAAGCAAGCACTTGGAAGAGCTTGTGGAGTCTCTAGGCCAGTGATTGCTTGTGCAGTCACCATAAAGGAAGGTTCCCAGCTGAAGCCTCAAATCCAGTCTCTTCAGCAGTCTATTGAGAGGCTGCTGGTGTAA
Full Trace Sequence: cggagttcccattaggtccattcgatcatcctccgtgaggcttgcgggctgagaggagaaactttcatcaccgatccgctgaacggataagcaccaagcgctgccatgactgaaccagaagtgaaccctaaagcctacccacttgcagatgcccagctcacaaaaacccttttggatcttgttcagcaagccgctaattacaagcagcttcgcaagggtgctaatgaagctacaaaaaccctaaacagaggcatagctgagtttatagtcatggcggctgatgcagaacccttggaaattattctacacctcccactcctgtgtgaagacaagaatgtcccctatgtgtttgtgcgctccaagcaagcacttggaagagcttgtggagtctctaggccagtgattgcttgtgcagtcaccataaaggaaggttcccagctgaagcctcaaatccagtctcttcagcagtctattgagaggctgctggtgtaatttgatggttgtatgttcaccttcccctttcagaagagctgtaaggcgtttcatcacactgtttgatttagtagctttcaaagaaaaccagtggtgagtttgtatctttggctggagccaagttacaacagcacaactgagtgaagtcttatgagttaacacatttaacagcaattgtagctgaggactatattgagctgtcatcagtttctttttacatttgcagttttgaattgcttttgtgtcaaacaggatcttgaaagatttattttcattacactgacttgtattgtatgtatttttaataaaaatatacatgtgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTEPEVNPKAYPLADAQLTKTLLDLVQQAANYKQLRKGANEATKTLNRGIAEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACAVTIKEGSQLKPQIQSLQQSIERLLV
Donor tissue: tadpole