ORFeome > nif3l1bp1 – XORFeome 2.0

nif3l1bp1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis nif3l1bp1 protein, mRNA (cDNA clone MGC:75670 IMAGE:5379970), complete cds
Gene Symbol: nif3l1bp1
Gene ID: 394707
ORF gb_acc: MG132837
ORF ID: 10187

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062491

Library Location

Plate ID: GDExt11003
Well Location: A04

EST Sequences

Clone: MGC:75670 IMAGE:5379970
Trimmed Sequence: ATGGGAGCCGTCACCGACGATGAAGTTATCCGCAAAAGACTTTTGATTGATGGAGATGGTGCCGGAGACGACCGAAGAATTAACTTATTGGTAAAGAGTTTTCTGAAATGGTGCAACTCGGGTTCCCAAGAAGAAGGCCAGTACCAACGCATGCTGAGCTCCTTGTCTCAATGTGAATTTTCCATGGGAAAAACACTTCTAGTGCATGATATGAATCTGCGGGAAATGGAAAACTATGAAAAAATATATGTTGATATAGAGAGTAGTATTGCTGCAGCACATGAGAAAATTGCAGAATGCAAAAAACAGATCTTGCAAGCCAAGCGAATCCGAAAGAATCGCCAAGAATATGATGCATTGGCCAAAGTTATTCAGCAACATCCAGACAGGCACGAAACCCTAAAGCAGCTGGAAGCTTTAGATAAAGAACTGAAACAGCTGTCGCACACAAAAGAAAATGTGGAAGACAAGCTGGAATTACGGAGGAAGCAGTTCCACGTTCTTCTCAGTACCATTCATGAGCTGCAACAGACCCTGGAAAATGATGACAAACTTGCTGAAGAATCTCAAGAGTCACCGATGGAAACTCAAAATCCATAG
Full Trace Sequence: ctcatcttctagggagtctgacctcactgctactcgccgccaccgccatgggagccgtcaccgacgatgaagttatccgcaaaagacttttgattgatggagatggtgccggagacgaccgaagaattaacttattggtaaagagttttctgaaatggtgcaactcgggttcccaagaagaaggccagtaccaacgcatgctgagctccttgtctcaatgtgaattttccatgggaaaaacacttctagtgcatgatatgaatctgcgggaaatggaaaactatgaaaaaatatatgttgatatagagagtagtattgctgcagcacatgagaaaattgcagaatgcaaaaaacagatcttgcaagccaagcgaatccgaaagaatcgccaagaatatgatgcattggccaaagttattcagcaacatccagacaggcacgaaaccctaaagcagctggaagctttagataaagaactgaaacagctgtcgcacacaaaagaaaatgtggaagacaagctggaattacggaggaagcagttccacgttcttctcagtaccattcatgagctgcaacagaccctggaaaatgatgacaaacttgctgaagaatctcaagagtcaccgatggaaactcaaaatccatagatgggatcttgtggccatagttctgcctccttagctggatataggaggcatgtaggggtgattatgggtatgatacatcattgcactgagatacctgtggaacagctttatgtgcagcaattttctgacctggaaacacttgctaaaaagcatcaagaattgtttgtttaattattgtagatgagatgctgttgtgtcagtatacatttaaagcattttttgcaataaaaccttttttaaacattaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFLKWCNSGSQEEGQYQRMLSSLSQCEFSMGKTLLVHDMNLREMENYEKIYVDIESSIAAAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQQHPDRHETLKQLEALDKELKQLSHTKENVEDKLELRRKQFHVLLSTIHELQQTLENDDKLAEESQESPMETQNP
Donor tissue: tadpole