ORFeome > nmd3 – XORFeome 2.0

nmd3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis 60S ribosomal export protein NMD3, mRNA (cDNA clone MGC:76205 IMAGE:5336066), complete cds
Gene Symbol: nmd3
Gene ID: 394998
ORF gb_acc: MG132771
ORF ID: 10081

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064238

Library Location

Plate ID: GDExt11001
Well Location: C12

EST Sequences

Clone: MGC:76205 IMAGE:5336066
Trimmed Sequence: ATGGAGTACATGAAAGGACCTGCAACAAGCAGCCAGGGCAACATACTTTGCTGCCAGTGTGGCATTCCTATTCCCCCAAATCCTGCCAACATGTGTGTATCCTGCTTGCGGATGCAGGTTGACATTAGCGAGGGCATTCCAAAGCAAGTTTCAGTGCATTTCTGCAAACAGTGTGAACGCTACCTGCAGCCCCCGGGAACCTGGATCCAATGTGCCTTGGAGTCAAGAGAGCTGCTTACTCTCTGTCTGAAAAAACTGAAGGCTAACTTGAGTAAAGTACGCCTTATCGATGCAGGTTTTATCTGGACTGAGCCACATTCAAAGAGGCTTAAAGTGAAGCTGACCATACAAAAGGAGGTGATGAATGGAGCAATTCTTCAGCAGGTCTTTGTTGTAGACTACATTGTTCAATCCCAGATGTGTGATGACTGCCATAGAGTAGAAGCTAAAGATTTCTGGAAAGCTGTGGTACAGGTTCGTCAAAAGGTTCTTCACAAGAAGACATTTTACTATTTGGAACAGACTATTCTGAAACACCGACTTCATCAGAACACACTGCGTGTCAAAGAGATTCATGATGGACTGGACTTCTACTATGCTTCCAAGCAGCATGCTCAGAAGATGGTGGAATTTCTACAGTGTACAGTGCCCTGCAGATTCAAAGCTTCCCAGCGCCTGATTTCACACGATATCCATACGAATGCCTACAATTACAAAAGCACATTTTCTGTGGAAATTGTTCCAGTTTGCAAGGACAACCTTGTATGCCTCTCTCCGAAGCTGGCACAGAGTCTTGGAAACATGAACCAGATATGTATTTGTGTCCGTGTTACCAGTACAATTCATCTGATTGACCCTAGCACTCTGCAGATTGCTGAGGTTGATGGAAACACTTACTGGCGATCTCCTTTCAACAGCTTGTTCCACCCCAAACAGTTGGAGGAGTTTATTGTGATGGACACTGACATAGTCAGAGACAGAAAACAAGCAGCAGGAGCAGGCATGAGATCAAACAAACACATACTTGCAGAGGTCTGGGTACAGAAAACATCTGAGATGAACACAACCCAGCAGTACCACTGCCGCACTCACTTGGGGCACCTGCTAAATCCAGGTGATCTCGTGTTGGGGTTTGATCTGGCTAATTGTAATCTGAATGACGAATTTATTAACAAGATGAACCCTCACCATATTCCTGATGTGGTTTTAATAAAGAAGAGTTATGATCGTACTAAGAGACAGCGGCGGAGGAACTGGAAGCTAAAGGAGATAGAAAGGGACAGGGAAGGCATGGACACGGATGACGAGAGGCAATATCAAGATTTTCTTGAAGACCTTGAAGAAGATGAAGTAATACGGAAGAACGTTAACATTTATAAAAATGCTAATTTGCCCGTAGAGAGTGACACTGACGAGGAGGGAGCCCCCCGGATCAGCCTTGCAGAAATGTTAGAAGATCTTCACATTTCACTGGATGCCACTGGTGGAGAAGGAGCAGAAATGCTGACAGAATAG
Full Trace Sequence: ctttagtggaaatggagtacatgaaaggacctgcaacaagcagccagggcaacatactttgctgccagtgtggcattcctattcccccaaatcctgccaacatgtgtgtatcctgcttgcggatgcaggttgacattagcgagggcattccaaagcaagtttcagtgcatttctgcaaacagtgtgaacgctacctgcagcccccgggaacctggatccaatgtgccttggagtcaagagagctgcttactctctgtctgaaaaaactgaaggctaacttgagtaaagtacgccttatcgatgcaggttttatctggactgagccacattcaaagaggcttaaagtgaagctgaccatacaaaaggaggtgatgaatggagcaattcttcagcaggtctttgttgtagactacattgttcaatcccagatgtgtgatgactgccatagagtagaagctaaagatttctggaaagctgtggtacaggttcgtcaaaaggttcttcacaagaagacattttactatttggaacagactattctgaaacaccgacttcatcagaacacactgcgtgtcaaagagattcatgatggactggacttctactatgcttccaagcagcatgctcagaagatggtggaatttctacagtgtacagtgccctgcagattcaaagcttcccagcgcctgatttcacacgatatccatacgaatgcctacaattacaaaagcacattttctgtggaaattgttccagtttgcaaggacaaccttgtatgcctctctccgaagctggcacagagtcttggaaacatgaaccagatatgtatttgtgtccgtgttaccagtacaattcatctgattgaccctagcactctgcagattgctgaggttgatggaaacacttactggcgatctcctttcaacagcttgttccaccccaaacagttggaggagtttattgtgatggacactgacatagtcagagacagaaaacaagcagcaggagcaggcatgagatcaaacaaacacatacttgcagaggtctgggtacagaaaacatctgagatgaacacaacccagcagtaccactgccgcactcacttggggcacctgctaaatccaggtgatctcgtgttggggtttgatctggctaattgtaatctgaatgacgaatttattaacaagatgaaccctcaccatattcctgatgtggttttaataaagaagagttatgatcgtactaagagacagcggcggaggaactggaagctaaaggagatagaaagggacagggaaggcatggacacggatgacgagaggcaatatcaagattttcttgaagaccttgaagaagatgaagtaatacggaagaacgttaacatttataaaaatgctaatttgcccgtagagagtgacactgacgaggagggagccccccggatcagccttgcagaaatgttagaagatcttcacatttcactggatgccactggtggagaaggagcagaaatgctgacagaatagacccacttcaaagcaatccgctgctgcatttttatcaagaggatttaaaatgtgtccaatttaatttgagcccatttataacacccactcatatgtgtctgtcggaacttcaatttccatacacaaagctcttgaatggtttgcatttctcctgtctgccaacattaaaataacaaatgcctaaaaaaaaaaaaaaaaaa
Translation: MEYMKGPATSSQGNILCCQCGIPIPPNPANMCVSCLRMQVDISEGIPKQVSVHFCKQCERYLQPPGTWIQCALESRELLTLCLKKLKANLSKVRLIDAGFIWTEPHSKRLKVKLTIQKEVMNGAILQQVFVVDYIVQSQMCDDCHRVEAKDFWKAVVQVRQKVLHKKTFYYLEQTILKHRLHQNTLRVKEIHDGLDFYYASKQHAQKMVEFLQCTVPCRFKASQRLISHDIHTNAYNYKSTFSVEIVPVCKDNLVCLSPKLAQSLGNMNQICICVRVTSTIHLIDPSTLQIAEVDGNTYWRSPFNSLFHPKQLEEFIVMDTDIVRDRKQAAGAGMRSNKHILAEVWVQKTSEMNTTQQYHCRTHLGHLLNPGDLVLGFDLANCNLNDEFINKMNPHHIPDVVLIKKSYDRTKRQRRRNWKLKEIERDREGMDTDDERQYQDFLEDLEEDEVIRKNVNIYKNANLPVESDTDEEGAPRISLAEMLEDLHISLDATGGEGAEMLTE
Donor tissue: tailbud