ORFeome > nmd3 – XORFeome 2.0

nmd3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis 60S ribosomal export protein NMD3, mRNA (cDNA clone MGC:89255 IMAGE:6976358), complete cds
Gene Symbol: nmd3
Gene ID: 394998
ORF gb_acc: MG133828
ORF ID: 11405

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC081303

Library Location

Plate ID: GDExt11013
Well Location: H07

EST Sequences

Clone: MGC:89255 IMAGE:6976358
Trimmed Sequence: ATGGAGTACATGAAAGGACCTGCAACAAGCAGCCAGGGCAACATACTTTGCTGCCAGTGTGGCATTCCTATTCCCCCAAATCCTGCCAACATGTGTGTATCCTGCTTGCGGATGCAGGTTGACATTAGCGAGGGCATTCCAAAGCAAGTTTCAGTGCATTTCTGCAAACAGTGTGAACGCTACCTGCAGCCCCCGGGAACCTGGATCCAATGTGCCTTGGAGTCAAGAGAGCTGCTTACTCTCTGTCTGAAAAAACTGAAGGCTAACTTGAGTAAAGTACGCCTTATCGATGCAGGTTTTATCTGGACTGAGCCACATTCAAAGAGGCTTAAAGTGAAGCTGACCATACAAAAGGAGGTGATGAATGGAGCAATTCTTCAGCAGGTCTTTGTTGTAGACTACATTGTTCAATCCCAGATGTGTGATGACTGCCATAGAGTAGAAGCTAAAGATTTCTGGAAAGCTGTGGTACAGGTTCGTCAAAAGGTTCTTCACAAGAAGACATTTTACTATTTGGAACAGACTATTCTGAAACACCGACTTCATCAGAACACACTGCGTGTCAAAGAGATTCATGATGGACTGGACTTCTACTATGCTTCCAAGCAGCATGCTCAGAAGATGGTGGAATTTCTACAGTGTACAGTGCCCTGCAGATTCAAAGCTTCCCAGCGCCTGATTTCACACGATATCCATACGAATGCCTACAATTACAAAAGCACATTTTCTGTGGAAATTGTTCCAGTTTGCAAGGACAACCTTGTATGCCTCTCTCCGAAGCTGGCACAGAGTCTTGGAAACATGAACCAGATATGTATTTGTGTCCGTGTTACCAGTACAATTCATCTGATTGACCCTAGCACTCTGCAGATTGCTGAGGTTGATGGAAACACTTACTGGCGATCTCCTTTCAACAGCTTGTTCCACCCCAAACAGTTGGAGGAGTTTATTGTGATGGACACTGACATAGTCAGAGACAGAAAACAAGCAGCAGGAGCAGGCATGAGATCAAACAAACACATACTTGCAGAGGTCTGGGTACAGAAAACATCTGAGATGAACACAACCCAGCAGTACCACTGCCGCACTCACTTGGGGCACCTGCTAAATCCAGGTGATCTCGTGTTGGGGTTTGATCTGGCTAATTGTAATCTGAATGACGAATTTATTAACAAGATGAACCCTCACCATATTCCTGATGTGGTTTTAATAAAGAAGAGTTATGATCGTACTAAGAGACAGCGGCGGAGGAACTGGAAGCTAAAGGAGATAGAAAGGGACAGGGAAGGCATGGACACGGATGACGAGAGGCAATATCAAGATTTTCTTGAAGACCTTGAAGAAGATGAAGTAATACGGAAGAACGTTAACATTTATAAAAATGCTAATTTGCCCGTAGAGAGTGACACTGACGAGGAGGGAGCCCCCCGGATCAGCCTTGCAGAAATGTTAGAAGATCTTCACATTTCACTGGATGCCACTGGTGGAGAAGGAGCAGAAATGCTGACAGAATAG
Full Trace Sequence: cgcttcctccccatgcttcactttggcacaactaagaaacctctttagtggaaatggagtacatgaaaggacctgcaacaagcagccagggcaacatactttgctgccagtgtggcattcctattcccccaaatcctgccaacatgtgtgtatcctgcttgcggatgcaggttgacattagcgagggcattccaaagcaagtttcagtgcatttctgcaaacagtgtgaacgctacctgcagcccccgggaacctggatccaatgtgccttggagtcaagagagctgcttactctctgtctgaaaaaactgaaggctaacttgagtaaagtacgccttatcgatgcaggttttatctggactgagccacattcaaagaggcttaaagtgaagctgaccatacaaaaggaggtgatgaatggagcaattcttcagcaggtctttgttgtagactacattgttcaatcccagatgtgtgatgactgccatagagtagaagctaaagatttctggaaagctgtggtacaggttcgtcaaaaggttcttcacaagaagacattttactatttggaacagactattctgaaacaccgacttcatcagaacacactgcgtgtcaaagagattcatgatggactggacttctactatgcttccaagcagcatgctcagaagatggtggaatttctacagtgtacagtgccctgcagattcaaagcttcccagcgcctgatttcacacgatatccatacgaatgcctacaattacaaaagcacattttctgtggaaattgttccagtttgcaaggacaaccttgtatgcctctctccgaagctggcacagagtcttggaaacatgaaccagatatgtatttgtgtccgtgttaccagtacaattcatctgattgaccctagcactctgcagattgctgaggttgatggaaacacttactggcgatctcctttcaacagcttgttccaccccaaacagttggaggagtttattgtgatggacactgacatagtcagagacagaaaacaagcagcaggagcaggcatgagatcaaacaaacacatacttgcagaggtctgggtacagaaaacatctgagatgaacacaacccagcagtaccactgccgcactcacttggggcacctgctaaatccaggtgatctcgtgttggggtttgatctggctaattgtaatctgaatgacgaatttattaacaagatgaaccctcaccatattcctgatgtggttttaataaagaagagttatgatcgtactaagagacagcggcggaggaactggaagctaaaggagatagaaagggacagggaaggcatggacacggatgacgagaggcaatatcaagattttcttgaagaccttgaagaagatgaagtaatacggaagaacgttaacatttataaaaatgctaatttgcccgtagagagtgacactgacgaggagggagccccccggatcagccttgcagaaatgttagaagatcttcacatttcactggatgccactggtggagaaggagcagaaatgctgacagaatagacccacttcaaagcaatccgctgctgcatttttatcaagaggatttaaaatgtgtccaatttaatttgagcccatttataacacccactcatatgtgtctgtcggaacttcaatttccatacacaaagctcttgaatggtttgcatttctcctgtctgccaacattaaaataacaaatgcctaaaaaaaaaaaaaaaacaatataaaaaaaaaaaaaaa
Translation: MEYMKGPATSSQGNILCCQCGIPIPPNPANMCVSCLRMQVDISEGIPKQVSVHFCKQCERYLQPPGTWIQCALESRELLTLCLKKLKANLSKVRLIDAGFIWTEPHSKRLKVKLTIQKEVMNGAILQQVFVVDYIVQSQMCDDCHRVEAKDFWKAVVQVRQKVLHKKTFYYLEQTILKHRLHQNTLRVKEIHDGLDFYYASKQHAQKMVEFLQCTVPCRFKASQRLISHDIHTNAYNYKSTFSVEIVPVCKDNLVCLSPKLAQSLGNMNQICICVRVTSTIHLIDPSTLQIAEVDGNTYWRSPFNSLFHPKQLEEFIVMDTDIVRDRKQAAGAGMRSNKHILAEVWVQKTSEMNTTQQYHCRTHLGHLLNPGDLVLGFDLANCNLNDEFINKMNPHHIPDVVLIKKSYDRTKRQRRRNWKLKEIERDREGMDTDDERQYQDFLEDLEEDEVIRKNVNIYKNANLPVESDTDEEGAPRISLAEMLEDLHISLDATGGEGAEMLTE
Donor tissue: tailbud