ORFeome > npc2 – XORFeome 2.0

npc2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis Niemann-Pick disease, type C2, mRNA (cDNA clone MGC:89994 IMAGE:7026175), complete cds
Gene Symbol: npc2
Gene ID: 493351
ORF gb_acc: MG133099
ORF ID: 10523

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080500

Library Location

Plate ID: GDExt11005
Well Location: F09

EST Sequences

Clone: MGC:89994 IMAGE:7026175
Trimmed Sequence: ATGTGTCCAGGATTACTGACCGTTCTGCTGACAGTCTTTCTTTTACCCAGTTCAGTTCCAGAGCCCCTTAAATACAAGGACTGTGGTAGCCAAAGTGGAAAACTAGTCACTCTTGATGTGTCTCCTTGCCCAGAAGAGCCATGCCCCCTGGTTCGAGGCAGCACATACACCGTTAATGCAACATTTGTAAGCAATGTAAACAGTAAGAGTGCTTCTGCTGTAGTACATGGAATCATAGCGGGTATTGCTGTCCCCTTCCCGATCTCAGAACCAGATGGCTGTAAAAGTGGTATATCCTGCCCGATCAACAGTGGGCAGACTTATACCTACGTCACCAAGTTGCCTATCAAGAGCGAGTATCCTTGTATCAAGCTTGTAGTAAAGTGGCAACTTCAGGATGAAAATAACAAGGATCTTTTCTGCTGGCTTATCCCTGTTCATATTGCTGCTGTTTGA
Full Trace Sequence: cgggaaagctctcaaaacatcacaagatctaaagctgctggaggcggtgagagttcgctgtgtactggaaggatgtcgtgtgccatcatgtgtccaggattactgaccgttctgctgacagtctttcttttacccagttcagttccagagccccttaaatacaaggactgtggtagccaaagtggaaaactagtcactcttgatgtgtctccttgcccagaagagccatgccccctggttcgaggcagcacatacaccgttaatgcaacatttgtaagcaatgtaaacagtaagagtgcttctgctgtagtacatggaatcatagcgggtattgctgtccccttcccgatctcagaaccagatggctgtaaaagtggtatatcctgcccgatcaacagtgggcagacttatacctacgtcaccaagttgcctatcaagagcgagtatccttgtatcaagcttgtagtaaagtggcaacttcaggatgaaaataacaaggatcttttctgctggcttatccctgttcatattgctgctgtttgattggggacttgacaccgaccatacttctgctaatcctatagacacacacaaacctcaattaacattgatacaagactttcttcttctgttctgactgctgtgcagttataaccatactgattttacaataataaagaatgaatgagagctcccccttgcttttttgttttttaataaaaaaaaaacttccatccttttcatgtttgctaacattttgcaaaggaattctgtttctctggaagcaaataaaactttgtctttagaaaaaaaaaaaaaaaaa
Translation: MCPGLLTVLLTVFLLPSSVPEPLKYKDCGSQSGKLVTLDVSPCPEEPCPLVRGSTYTVNATFVSNVNSKSASAVVHGIIAGIAVPFPISEPDGCKSGISCPINSGQTYTYVTKLPIKSEYPCIKLVVKWQLQDENNKDLFCWLIPVHIAAV
Donor tissue: