ORFeome > npm1 – XORFeome 2.0

npm1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis nucleophosmin (nucleolar phosphoprotein B23, numatrin), mRNA (cDNA clone MGC:75688 IMAGE:5380244), complete cds
Gene Symbol: npm1
Gene ID: 394478
ORF gb_acc: MG132884
ORF ID: 10247

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059736

Library Location

Plate ID: GDExt11003
Well Location: F04

EST Sequences

Clone: MGC:75688 IMAGE:5380244
Trimmed Sequence: ATGGAAGACTCCATGGATATGGATAGCATTGCTCCCCTGCGCCCTCAGAATTTTCTCTTTGGATGTGAACTTAAAGCAGACAAAAGAGAATATTCATTTAAAGTTGAAGATGATGAAAATGAGCACCAATTGTCATTGAGAACGGTTAGTGTGGGTGCATCTGCTAAAGATGAGCTGCATGTTGTTGAGGCTGAAGGAATAAATTATGAAGGGAAAACCATTAAAATTACACTTGCCTCATTGAAGCCATCTGTGCAACCAACGGTTTCTCTAGGGGGATTTGAGATAACACCACCAGTAATCTTGCGGTTGAAATCTGGGTCAGGGCCAGTATATGTCAGTGGGCAGCATCTTGTGGCTTTAGAAGATCTTGAATCCACAGATGATGAAGATGAGGAACATGATGTGCCCAGTCCAAAAAATGCAAAAAGGACGGCATCAGATGCTGCATCAAAGGTTCCTCGGAAAAAAACACGTCTGGAGGAAGAGGACGAGGCTGATTCAGACGAGGATGATGATGATGATGACGATGATGAGGAGGAGGACGACGAAGATGAGGATGAAGAGGATGAAACACCTGTTAAAAAGACTGACTTGCCTACAAAACCAAAGGCAGCTCAAAAGTTAAATCACAATGGGAAGGCTTCTGAATTACCCACACCACTAAAGACTCCAAAAACTCCAGAGCAGAAAGGAAAGCAGGATACAAAGCCTCAAACACCAAAGACACCAAAAACGCCTTTGTCTTTTGATGAAATAAAAGCAAAGATGCAAACTTCATTAGAAAAGGGCACTGTTCTTCCTAAAGTGGAAGTAAAGTTTGCAAACTATGTGAAGAATTGCTTTAGGACAGAAAATCAGAAGGTAATTCAAGATCTTTTCAAATGGAGACAGTCCCTGAAAGACTCAAAATAA
Full Trace Sequence: gtccgtgccgctgtagagtagagggggtacatctgaattgaattggaacaaaatggaagactccatggatatggatagcattgctcccctgcgccctcagaattttctctttggatgtgaacttaaagcagacaaaagagaatattcatttaaagttgaagatgatgaaaatgagcaccaattgtcattgagaacggttagtgtgggtgcatctgctaaagatgagctgcatgttgttgaggctgaaggaataaattatgaagggaaaaccattaaaattacacttgcctcattgaagccatctgtgcaaccaacggtttctctagggggatttgagataacaccaccagtaatcttgcggttgaaatctgggtcagggccagtatatgtcagtgggcagcatcttgtggctttagaagatcttgaatccacagatgatgaagatgaggaacatgatgtgcccagtccaaaaaatgcaaaaaggacggcatcagatgctgcatcaaaggttcctcggaaaaaaacacgtctggaggaagaggacgaggctgattcagacgaggatgatgatgatgatgacgatgatgaggaggaggacgacgaagatgaggatgaagaggatgaaacacctgttaaaaagactgacttgcctacaaaaccaaaggcagctcaaaagttaaatcacaatgggaaggcttctgaattacccacaccactaaagactccaaaaactccagagcagaaaggaaagcaggatacaaagcctcaaacaccaaagacaccaaaaacgcctttgtcttttgatgaaataaaagcaaagatgcaaacttcattagaaaagggcactgttcttcctaaagtggaagtaaagtttgcaaactatgtgaagaattgctttaggacagaaaatcagaaggtaattcaagatcttttcaaatggagacagtccctgaaagactcaaaataaacctgcctcttgttatcaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MEDSMDMDSIAPLRPQNFLFGCELKADKREYSFKVEDDENEHQLSLRTVSVGASAKDELHVVEAEGINYEGKTIKITLASLKPSVQPTVSLGGFEITPPVILRLKSGSGPVYVSGQHLVALEDLESTDDEDEEHDVPSPKNAKRTASDAASKVPRKKTRLEEEDEADSDEDDDDDDDDEEEDDEDEDEEDETPVKKTDLPTKPKAAQKLNHNGKASELPTPLKTPKTPEQKGKQDTKPQTPKTPKTPLSFDEIKAKMQTSLEKGTVLPKVEVKFANYVKNCFRTENQKVIQDLFKWRQSLKDSK
Donor tissue: tadpole