ORFeome > nucks1 – XORFeome 2.0

nucks1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis nuclear casein kinase and cyclin-dependent kinase substrate 1, mRNA (cDNA clone MGC:75738 IMAGE:5381323), complete cds
Gene Symbol: nucks1
Gene ID: 394795
ORF gb_acc: MG132937
ORF ID: 10306

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063335

Library Location

Plate ID: GDExt11004
Well Location: G02

EST Sequences

Clone: MGC:75738 IMAGE:5381323
Trimmed Sequence: ATGTCCAGGCCGGTCAGGAACAGAAAAGTCGTTGATTACTCTCAGTTTCAAGATTCAGACGATGAAGACTATGGAAGAGATTCTGCTCCACCTTCAAAAAAGGCACGTGCATCTTCTAGAGAAGTGAAGGAAAAAAGGTCTGGGAAAAATTCACAAGAAGACAGTGAGGAATCTGATGAAAAGGATACAAAGAAACCAAAAAAGGAAGGAGACTCTGCAGAAGACTTTGGCAGTGAAGATGACTTGGCAGAGGGAGATGGAAAAGCAGATAGTGACTATGAAAGTCCAAAGCGTAGTAAAAAAGGCAAAAAACCTACCCCTGACAAGAAGAGAGCCTCCAAGCAAAGGAAAAGATCTGCACCAGATGACAGTGATGATGAAAAGCAACGTAAAAATGTGAGACAGCAGAGGCAAGCAGCATCTAAAGCGGCTTCTAAACAAAGGGAGATGTTAATGGGTGATGGAGGCAGTGAGGATGAAGAGCAGGAGGAAGAAGATGAAGCACAGTTCCTGGAAAAGGATTCTGGGAGTGATGAAGATTTCATGGTAGAAGATGATGATGACAGTGATTATGGCCGCTCCAAGAAGAAGAAAAAGATTGTTAAAAAATCTAAACCAGAAAGGAAAGAAAAGAGGGTACCTAAGCCCAGACTAAAAGCTACAGTAACACCCAGTCCCGTAAAGGCCAAAGGAAAAAGTCGCCCTGCTGCTTCAAAGGCTCCTAAGGAAAAATCTTTATCTCCCAAAGCAGAGGATGAGGAAGAGGAGGATGATGAGCCAGTGACGCCACCACCAGAGAAGAAGTCTACCAGTCCACAACAGGAAAAATCTGGAGATGATGTGTCTGATGAAGAAGCTCAGTCCACTGAGGACTAG
Full Trace Sequence: cggagctgtcccaaggaacgtatttgattttttttttttaattttatttttcatttttattttatttccaatcagtatttatttcccaggccttgcgaggaaaggaaaattatacgactgggcctaattacttacaccctcctctatccatcacccccgccctccataaagcggccaccgcggggggtcttgtacaaaggaagccgctcttcactctcttccgattctcgttgctgctcacttggaatctgcaggaacaatgtccaggccggtcaggaacagaaaagtcgttgattactctcagtttcaagattcagacgatgaagactatggaagagattctgctccaccttcaaaaaaggcacgtgcatcttctagagaagtgaaggaaaaaaggtctgggaaaaattcacaagaagacagtgaggaatctgatgaaaaggatacaaagaaaccaaaaaaggaaggagactctgcagaagactttggcagtgaagatgacttggcagagggagatggaaaagcagatagtgactatgaaagtccaaagcgtagtaaaaaaggcaaaaaacctacccctgacaagaagagagcctccaagcaaaggaaaagatctgcaccagatgacagtgatgatgaaaagcaacgtaaaaatgtgagacagcagaggcaagcagcatctaaagcggcttctaaacaaagggagatgttaatgggtgatggaggcagtgaggatgaagagcaggaggaagaagatgaagcacagttcctggaaaaggattctgggagtgatgaagatttcatggtagaagatgatgatgacagtgattatggccgctccaagaagaagaaaaagattgttaaaaaatctaaaccagaaaggaaagaaaagagggtacctaagcccagactaaaagctacagtaacacccagtcccgtaaaggccaaaggaaaaagtcgccctgctgcttcaaaggctcctaaggaaaaatctttatctcccaaagcagaggatgaggaagaggaggatgatgagccagtgacgccaccaccagagaagaagtctaccagtccacaacaggaaaaatctggagatgatgtgtctgatgaagaagctcagtccactgaggactagcacctttcagggtgtgtgggggggacttggggtgagggtgattgttggggaaattttattaaaaaatacaagttaaaaaagaaaaaaaagccggttgggttaagatcatgacttgggctattgcttgactcatgcacctccaatgctgtctttcatttctgttttaagagttacttgcagtttcttttttttaaatattattttaaccagcaaaaggtgaaacatttttgccatttttgggattattgatcattgttcccattacctgtctgaaataaagccatgcacatttttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSRPVRNRKVVDYSQFQDSDDEDYGRDSAPPSKKARASSREVKEKRSGKNSQEDSEESDEKDTKKPKKEGDSAEDFGSEDDLAEGDGKADSDYESPKRSKKGKKPTPDKKRASKQRKRSAPDDSDDEKQRKNVRQQRQAASKAASKQREMLMGDGGSEDEEQEEEDEAQFLEKDSGSDEDFMVEDDDDSDYGRSKKKKKIVKKSKPERKEKRVPKPRLKATVTPSPVKAKGKSRPAASKAPKEKSLSPKAEDEEEEDDEPVTPPPEKKSTSPQQEKSGDDVSDEEAQSTED
Donor tissue: tadpole