ORFeome > oaz1 – XORFeome 2.0

oaz1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ornithine decarboxylase antizyme 1, mRNA (cDNA clone MGC:75770 IMAGE:5381834), complete cds
Gene Symbol: oaz1
Gene ID: 394475
ORF gb_acc: MG132916
ORF ID: 10282

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059754

Library Location

Plate ID: GDExt11004
Well Location: E02

EST Sequences

Clone: MGC:75770 IMAGE:5381834
Trimmed Sequence: ATGCTTCTCCGAACATTCAGATTCTTGGGCTTTGAGATTGTGATACCTGGACATCCCCTTGTCCCTAAGAGACCAGATGCTTGCTTTATGGCTTACACCTTTGAAAGAGATTCTTCTGATGAAGATTAG
Full Trace Sequence: cgcggcagaaagcgggggattttctggttccgagaccagagaggccggatggtgaaatcctccctccagcggatactcaatagccattgctttgccagagaaaaagaaggaaataaaagaaactgcgccatgcctcttctgagtatacccagtagtagtgaaagttccagagtttctttcaattgctgtagtaacctgggtcccgggcctcggtggtgttcctgatgtccctcacccacccctgaagatcccaggtgggcgagggaatagtcagagggatcacaatctttcagctaatttattttattctgataataggctgaacataacagaagagcttacatccaataacaggaccagaatactcaatgtccaatcaagtctgacagacggcaaacaactttgcaattctactagaatatgcagaagagcaactccaagtgggtcatgtctttatctgcttccacaagaacagggatgatagagccatgcttctccgaacattcagattcttgggctttgagattgtgatacctggacatccccttgtccctaagagaccagatgcttgctttatggcttacacctttgaaagagattcttctgatgaagattagacagccctgcaatgtttgcttttttttttttctttgccctacccacatctagagatggaatgcgagaaatcttgtcaatttaagctgttgatttatgcctgtgcccatttgggactgagagaagaggcaagatcttgagattttcatccttttttttccagaagttttttgtctgcatgttatgaataaatgccactccagattattgctatatgaatggaggtttaatgtgttttgtgatagcagagtactttttctttaattctaaataaaacatttatattttaaaaaaaaaaaaaaa
Translation: MLLRTFRFLGFEIVIPGHPLVPKRPDACFMAYTFERDSSDED
Donor tissue: tadpole