ORFeome > omp – XORFeome 2.0

omp – XORFeome 2.0

General Information

Species: Xenopus tropicalis olfactory marker protein, mRNA (cDNA clone MGC:75776 IMAGE:5381883), complete cds
Gene Symbol: omp
Gene ID: 394662
ORF gb_acc: MG132909
ORF ID: 10274

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061304

Library Location

Plate ID: GDExt11003
Well Location: H06

EST Sequences

Clone: MGC:75776 IMAGE:5381883
Trimmed Sequence: ATGGAGCTTCCGTTCAACGACGATGCTCAGCTCACCAAGTGCATGCGTATCCGAGTCCAGAGCCTCCAGCAGAAGAACGCCAAACCCCAAGAGGGCGAGATGCTCCTCCGAGCCAACCAGTTCGTCTATCGGCTGGATTTCTCCAAGCAGAAGCTCAAATTCCTGTGGTGGAAGGTCCATTTGAAAACACCGGGGAAAGTCACGATCACCGGCACCTCCCAGCACTGGACCCCGGATCTCACCAACCTCATGACCCGGCAGCTTCTGGAACCTTCCGCCGTCTTCTCCAAGAAAGACGCAAAGGACCCGGTGGAGTGCAACGAGGCCGATGCCCAGGAGTTTGGGGAAAGGATAGCGGAGTTGGCCAAAATACGCAAAGTCATGTACTTTGTCTTCACTTTCTCAGACGGCACCGACCCGTCCGCCATCAAATGTTCCATTGGCCTCAGGGGCTGA
Full Trace Sequence: cgcggaggcaagcagacgtagatcactagcccggctgaggagcaatggcatctgaaacctcagagatggagcttccgttcaacgacgatgctcagctcaccaagtgcatgcgtatccgagtccagagcctccagcagaagaacgccaaaccccaagagggcgagatgctcctccgagccaaccagttcgtctatcggctggatttctccaagcagaagctcaaattcctgtggtggaaggtccatttgaaaacaccggggaaagtcacgatcaccggcacctcccagcactggaccccggatctcaccaacctcatgacccggcagcttctggaaccttccgccgtcttctccaagaaagacgcaaaggacccggtggagtgcaacgaggccgatgcccaggagtttggggaaaggatagcggagttggccaaaatacgcaaagtcatgtactttgtcttcactttctcagacggcaccgacccgtccgccatcaaatgttccattggcctcaggggctgaggtgaatttaatgtgggacaaaaacattgtgacttgtgactccaaccacttatgtcccaattaactcttcattagatgcccaataaaggatgaataattcaaatccggccaatggacttggtcatgcagtgtatgaataacgatgatccacttcccaccgtaacggtgcggtttccatcctaattattaatgatgttctagatgttctaggttatcttattgcttcattattgtagagggtcaggtgggaccaaatcaaaagtataaacgttcagattagtagacatgaacgggacaggtgatattgtctatttccaggtcagtaggtgagactgggagaacctacctcccctgtagccacctaaccccgagcctaacagaaactcctctgtttatgtaactaaggcatttactcaatgttcagaactttccctgggttggggatctgttgttgagttgttggccaaccagaaggcttgttgcatctgtaccacctcccactgatcagtgaagatagaatgaatactatagtaggtctaattggtggccccaccatattgtatcctttgtaccacagcaggaattgaattgggttccggttctgccgactattgggctttaattgactcacgttaatggttttattatattcacagtgacacattctatttatctgctgcaaaataaagtttatttaaagtttaagaacaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MELPFNDDAQLTKCMRIRVQSLQQKNAKPQEGEMLLRANQFVYRLDFSKQKLKFLWWKVHLKTPGKVTITGTSQHWTPDLTNLMTRQLLEPSAVFSKKDAKDPVECNEADAQEFGERIAELAKIRKVMYFVFTFSDGTDPSAIKCSIGLRG
Donor tissue: tadpole