ORFeome > pelo – XORFeome 2.0

pelo – XORFeome 2.0

General Information

Species: Xenopus tropicalis pelota homolog, mRNA (cDNA clone MGC:69327 IMAGE:5308903), complete cds
Gene Symbol: pelo
Gene ID: 448078
ORF gb_acc: MG133314
ORF ID: 10811

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074604

Library Location

Plate ID: GDExt11008
Well Location: E04

EST Sequences

Clone: MGC:69327 IMAGE:5308903
Trimmed Sequence: ATGAAGCTGATAAGCAAAGACATCGAAAAGGACAATGCGGGGCAGGTGACATTGATCCCCGAAGAGGCAGAAGACATGTGGCACACGTACAACTTGATGCAGGTCGGAGACAGTCTGCGGGCGTCGACAATCAGGAAAGTGCAGACTGAATCCTCCACAGGCAGCGTGGGCAGTAACCGCATTCGCACCACGCTCACCATATGCGTAGAGACCATCGATTTTGATTCCCAAGCCTGTCAGCTGAGAGTCAAGGGAATAAATATCCAGGAGAACCAGTATGTGAAGATGGGAGCCTACCATACCATAGAACTGGAGCCAAACCGCAAGTTCACACTGGCCAAGAAACAGTGGGACAGCGTTGTACTGGAGAGGATTGAGCAGGCCTGTGACCCTGCATTCAGTGCAGATGTTGGCGCTGTAGTGATGCAGGAGGGTCTGGCCCACATCTGCCTGGTCACGCCCAGTATGACACTTCTCCGAGCCAAGATTGAGACCAGCATTCCACGCAAGAGGAGGGGCAACTGTACCCAGCATGAAAAGGCTCTAGAGAAGTTTTATGAGCAGGTTATGCAGGGAATTCTGCGGCACATCAACTTTGATGTGGTAAAGGTGGTCCTTGTTGCCTCTCCCGGCTTTGTTCGGGAGCAGTTTTGCGAGTTCCTTTTCCTGCGAGCCGTGAAACAGGATATAAAGTTACTGCTGGAAAACCGCGGCAAATTCCTACAAGTTCACAGCTCATCCGGGCACAAGTACTCTCTCACAGAGGTTCTGTGTGATCCAGCAGTGACAGCGCGCCTGGCAGACACAAAGGATAAAGCAAGTAGAAAAAGCAAACGAAGCTCTGGCCATTGA
Full Trace Sequence: gttggacgtggcttggcagactggagtgtagtatgtgcaaacttctagccggacaccggcagtgagctgggtacaggactcagcccttgcggctgcacttacaggcaacaatgaagctgataagcaaagacatcgaaaaggacaatgcggggcaggtgacattgatccccgaagaggcagaagacatgtggcacacgtacaacttgatgcaggtcggagacagtctgcgggcgtcgacaatcaggaaagtgcagactgaatcctccacaggcagcgtgggcagtaaccgcattcgcaccacgctcaccatatgcgtagagaccatcgattttgattcccaagcctgtcagctgagagtcaagggaataaatatccaggagaaccagtatgtgaagatgggagcctaccataccatagaactggagccaaaccgcaagttcacactggccaagaaacagtgggacagcgttgtactggagaggattgagcaggcctgtgaccctgcattcagtgcagatgttggcgctgtagtgatgcaggagggtctggcccacatctgcctggtcacgcccagtatgacacttctccgagccaagattgagaccagcattccacgcaagaggaggggcaactgtacccagcatgaaaaggctctagagaagttttatgagcaggttatgcagggaattctgcggcacatcaactttgatgtggtaaaggtggtccttgttgcctctcccggctttgttcgggagcagttttgcgagttccttttcctgcgagccgtgaaacaggatataaagttactgctggaaaaccgcggcaaattcctacaagttcacagctcatccgggcacaagtactctctcacagaggttctgtgtgatccagcagtgacagcgcgcctggcagacacaaaggataaagcaagtagaaaaagcaaacgaagctctggccattgacatcctactagttactgacgaactgttcagacatcaggacgtgccgacgcggactcgctacgttagacttgtggacagcgtgaaggataacggggggactgtaaggatcttttccagtttacatgtctcaggagagcagttaaaccagttgacgggagtggcggccatcttgcgcttcccagtggcggacctctccgatgaagagtcaagctccgacgatgattagactaatttattcttgtatttctgctcctctgttggttgcaattggacactgcccatgttgtcaccgggcaaagaaatagaaatcaaactccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MKLISKDIEKDNAGQVTLIPEEAEDMWHTYNLMQVGDSLRASTIRKVQTESSTGSVGSNRIRTTLTICVETIDFDSQACQLRVKGINIQENQYVKMGAYHTIELEPNRKFTLAKKQWDSVVLERIEQACDPAFSADVGAVVMQEGLAHICLVTPSMTLLRAKIETSIPRKRRGNCTQHEKALEKFYEQVMQGILRHINFDVVKVVLVASPGFVREQFCEFLFLRAVKQDIKLLLENRGKFLQVHSSSGHKYSLTEVLCDPAVTARLADTKDKASRKSKRSSGH
Donor tissue: gastrula